DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and hspb9

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001108177.1 Gene:hspb9 / 100137108 ZFINID:ZDB-GENE-080214-6 Length:204 Species:Danio rerio


Alignment Length:132 Identity:30/132 - (22%)
Similarity:51/132 - (38%) Gaps:10/132 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LDVCARDFHLRMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSD 109
            |:....||...:|      ||....|:.   .|:|:...:....:.||...|...:::|......
Zfish    55 LNELCEDFFQTLD------GSSTFSRLF---STDPEQKKKQDVSLTLDTRGFSPEDVSVTVSGRR 110

  Fly   110 TVCVEGKQADDRAEKGQL-CITREFTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDVER 173
            ...:.||:|:..|..... ...:||.::.:||.|.|......:...||:|.|..|...|.:..|.
Zfish   111 LEVMAGKRAEKNASSSSAESQAQEFVQAVQLPDHLDPASLTCSLGEDGLLHIETPEETKDESSEE 175

  Fly   174 EI 175
            .:
Zfish   176 HV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 18/76 (24%)
hspb9NP_001108177.1 IbpA 38..180 CDD:223149 30/132 (23%)
ACD_HspB9_like 79..166 CDD:107236 19/86 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.