DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13133 and cryaa

DIOPT Version :9

Sequence 1:NP_609343.1 Gene:CG13133 / 34342 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:86 Identity:34/86 - (39%)
Similarity:47/86 - (54%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQA 148
            |..|.|.|||.||...||:||. ..|.|.::||..:.:.:.|.  |:|||.|.|:||.:.|.:..
Zfish    69 REKFTVYLDVKHFSPDELSVKV-TDDYVEIQGKHGERQDDHGY--ISREFHRRYRLPSNVDQSAI 130

  Fly   149 RATFSADGILMITVPAPPKLD 169
            ..|.||||:|.:..|....:|
Zfish   131 TCTLSADGLLTLCGPKTSGID 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/75 (41%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 32/79 (41%)
IbpA <64..146 CDD:223149 32/79 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.