DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL6 and Fcrl6

DIOPT Version :9

Sequence 1:XP_005245185.1 Gene:FCRL6 / 343413 HGNCID:31910 Length:444 Species:Homo sapiens
Sequence 2:XP_011237162.1 Gene:Fcrl6 / 677296 MGIID:3618339 Length:308 Species:Mus musculus


Alignment Length:251 Identity:113/251 - (45%)
Similarity:148/251 - (58%) Gaps:12/251 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    89 GQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSAL 153
            |.:|||.......:.:...|       .||||.|.|:...:.|..:   |.|:|..|:.|....|
Mouse    30 GWFSCSVSPWLKLKLWIHVS-------PELFPNPELTEFTNSETMD---VILKCTIKVDPKNPTL 84

Human   154 RLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPV 218
            :|.::|:|:.|.:|||.|| .:....|||.:||||.|.|..|.|.:||:|..|:::...|||.||
Mouse    85 QLFYTFYKNNHVIQDRSPH-SVFSAEAKEENSGLYQCMVDTEDGLIQKKSGYLDIQFWTPVSHPV 148

Human   219 LTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGN 283
            |||.|...:.||||.|:.||||.:||.||.||||::.:|:|...||.|...|||..||:|....|
Mouse   149 LTLQHEATNLAVGDKVEFLCEAHQGSLPIFYSFYINGEILGKPLAPSGRAASLLASVKAEWSTKN 213

Human   284 YSCEAENSVSRERSEPKKLSLKGSQVLFTPASNWLVPWLPASLLGLMVIAAALLVY 339
            |||||:|::|||.||.||..|..|...:. .||.|..||||||||.|||||.:|:|
Mouse   214 YSCEAKNNISREISELKKFPLVVSGTAWI-KSNMLPIWLPASLLGGMVIAAVVLMY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL6XP_005245185.1 Ig2_FcgammaR_like 29..108 CDD:143230 4/18 (22%)
Ig_2 122..210 CDD:290606 33/87 (38%)
IG_like 133..208 CDD:214653 30/74 (41%)
Ig_3 216..290 CDD:290638 40/73 (55%)
Fcrl6XP_011237162.1 Ig_2 50..133 CDD:372793 35/86 (41%)
Ig_C17orf99 161..229 CDD:375301 37/67 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I52824
eggNOG 1 0.900 - - E1_2DMWR
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88414
Inparanoid 1 1.050 195 1.000 Inparanoid score I16299
Isobase 00.000 Not matched by this tool.
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0015430
OrthoInspector 1 1.000 - - oto115111
orthoMCL 1 0.900 - - OOG6_135152
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12643
SonicParanoid 1 1.000 - - X12282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1313.290

Return to query results.
Submit another query.