DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL6 and ihog

DIOPT Version :9

Sequence 1:XP_005245185.1 Gene:FCRL6 / 343413 HGNCID:31910 Length:444 Species:Homo sapiens
Sequence 2:NP_609085.1 Gene:ihog / 33972 FlyBaseID:FBgn0031872 Length:886 Species:Drosophila melanogaster


Alignment Length:358 Identity:77/358 - (21%)
Similarity:124/358 - (34%) Gaps:93/358 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    39 VFEGDALTLRC-QGWKNTPLSQVKFYRDGKFL--HFSKENQTLSMGAATVQSRGQYSC------S 94
            |..|:::...| |..::.|.:...:||:|..:  .|...|..|.:...:.:|.|.|||      |
  Fly   169 VSAGNSVLWSCGQQVQSNPSASWSYYRNGVEIKPEFIGTNGNLFLSNVSSESSGSYSCQATNPAS 233

Human    95 GQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEP---REGSLVTLRCQTKLHP-------- 148
            |:.:.:|.:.  ..:....|..|...|.:|...||.:.   ||||.:.|.|.....|        
  Fly   234 GERIQLPGSL--QLQVTPEQRSESKSPHLLRGQPSSQEITIREGSSLLLLCPGVGSPPPTVVWSS 296

Human   149 ------LRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLE 207
                  :::....:|     ||.|:         |...:..|:|.|.|      .|.....|.||
  Fly   297 PDVVGAVKNKRSKVF-----GHALE---------ISNTRVNDAGTYIC------FQDNGVRPALE 341

Human   208 VRVQAPVSRPVLTLHHGPAD-PAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSL 271
            ..::..|.:|...:....|| ...||.::|.|:|.....|.:|........:.:..|.......:
  Fly   342 HYIKVHVEQPPQIVRPPWADLTNEGDRLKLECKATGVPTPEIYWLLNGHSSIDDSEAELSNNFLI 406

Human   272 LFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNWLVPWLPASLLGLMVIAAAL 336
            |..| .::.||...|.|.|.:. |.|....|.:...|                            
  Fly   407 LHSV-LKRHAGYVQCFARNRLG-EHSAGTLLQVNPKQ---------------------------- 441

Human   337 LVYVRSWRKAG----PLPSQ-------IPPTAP 358
               ::..|::|    |.|:|       .|||.|
  Fly   442 ---IQEPRESGGTHRPKPNQGSRQKQMYPPTPP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL6XP_005245185.1 Ig2_FcgammaR_like 29..108 CDD:143230 19/77 (25%)
Ig_2 122..210 CDD:290606 23/104 (22%)
IG_like 133..208 CDD:214653 19/88 (22%)
Ig_3 216..290 CDD:290638 17/74 (23%)
ihogNP_609085.1 IG_like 59..145 CDD:214653
ig 265..330 CDD:278476 17/78 (22%)
IG_like 267..348 CDD:214653 20/100 (20%)
Ig 314..>377 CDD:299845 19/77 (25%)
IG_like 364..437 CDD:214653 18/74 (24%)
IGc2 365..427 CDD:197706 15/62 (24%)
FN3 467..565 CDD:238020 4/5 (80%)
fn3 580..655 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.