DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL6 and unc-40

DIOPT Version :9

Sequence 1:XP_005245185.1 Gene:FCRL6 / 343413 HGNCID:31910 Length:444 Species:Homo sapiens
Sequence 2:NP_491664.1 Gene:unc-40 / 172233 WormBaseID:WBGene00006776 Length:1415 Species:Caenorhabditis elegans


Alignment Length:441 Identity:92/441 - (20%)
Similarity:156/441 - (35%) Gaps:95/441 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    32 LQAWPNPVFEGDALTLRCQ-GWKNTPLSQVKFYRD-----GKFLHFSKENQTLSMGAATVQSRGQ 90
            |||....:.:|......|. ..|.|| :.|..:.|     |...|....:.||.:.:...:..|.
 Worm   152 LQAIDRTLAKGQPTAFHCLINSKPTP-TAVWLHNDEPIVNGGEYHILPVSNTLEISSTQSRHEGT 215

Human    91 YSC---------SGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRC---- 142
            |.|         |.|...:..| |:|....:|    ....|.|..:     .:|....|.|    
 Worm   216 YRCTVEGAGKRRSSQTARLTVT
-TETVSNELV----FITTPRLQVV-----EQGDEFLLECLVAS 270

Human   143 --QTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQ 205
              :.::..|:.:.:::.    ||..::..|. ..:.:..|...|:|||.|..:.....:.:   .
 Worm   271 LIRPQVRWLKDSRQIIV----DGVRIRRVGV-SSILVSRASIEDTGLYTCRASNNDDSIDR---A 327

Human   206 LEVRVQAP---VSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLD-EKIVGNH---SA 263
            :.|.|:||   .:||...:....||      |:|.|......|....::|.: |.|:|:.   ..
 Worm   328 VSVEV
RAPPRITTRPTTKVAVETAD------VELECGTAAARPEARVNWYKNGEAIIGSEYFVIE 386

Human   264 PCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKL--SLKGSQVLFTPASNWLVPWLPASL 326
            |  ....:|..|:::|  ..|.|.|||.|..|::..:.|  :...|.|    |::..||...::.
 Worm   387 P--NRLRILGVVRADQ--AIYQCIAENDVGSEQASAQLLVDAPDSSSV----AASSGVPMTSSAP 443

Human   327 LGLMVIAAALLVYVRSWRKAGPLPSQIPPTAPGGEQCPLYANVHHQKGKDEGVVYSVVHRTSKRS 391
            |||...::........|.         ||....|       |:         :.|.:.::.:...
 Worm   444 LGLRSTSSGSRFINVEWD---------PPVQRNG-------NI---------MRYHIFYKDNLID 483

Human   392 EARSAEFTVGRKDSSIICAEVRCLQPSEVSSTEVNMRSRTLQEPLSDCEEV 442
            ..|..       :||...|.:..||||.:....|...:.......||..:|
 Worm   484 RERMI-------NSSSTSATLTSLQPSTMYLIRVTAENEAGMGKFSDSLKV 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL6XP_005245185.1 Ig2_FcgammaR_like 29..108 CDD:143230 21/90 (23%)
Ig_2 122..210 CDD:290606 16/93 (17%)
IG_like 133..208 CDD:214653 13/80 (16%)
Ig_3 216..290 CDD:290638 19/77 (25%)
unc-40NP_491664.1 I-set 42..130 CDD:254352
Ig 43..142 CDD:299845
I-set 149..236 CDD:254352 19/84 (23%)
Ig 158..237 CDD:299845 16/79 (20%)
IG_like 251..332 CDD:214653 16/93 (17%)
IGc2 258..320 CDD:197706 13/66 (20%)
I-set 336..422 CDD:254352 23/95 (24%)
Ig 352..422 CDD:299845 20/79 (25%)
FN3 441..529 CDD:238020 21/119 (18%)
FN3 536..627 CDD:238020
FN3 635..727 CDD:238020
FN3 738..816 CDD:214495
FN3 852..927 CDD:214495
FN3 946..1038 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.