DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCRL6 and si:dkey-23a13.11

DIOPT Version :9

Sequence 1:XP_005245185.1 Gene:FCRL6 / 343413 HGNCID:31910 Length:444 Species:Homo sapiens
Sequence 2:XP_021333780.1 Gene:si:dkey-23a13.11 / 100006263 ZFINID:ZDB-GENE-160113-14 Length:1089 Species:Danio rerio


Alignment Length:409 Identity:91/409 - (22%)
Similarity:137/409 - (33%) Gaps:142/409 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    37 NPVFEGDALTLRCQGWKNTPLSQVKFY--RDGKFLHFSKE---NQTLSMGAATVQSRGQYSCSGQ 96
            ||||.|:.:.|.|.  ..|..|..:::  :|...||.|..   |:.:....|....:|||.|.|:
Zfish   229 NPVFTGETVNLTCV--ITTYYSIWRYFWDKDDGVLHLSHRHSVNRDILTIRAAESDQGQYWCWGE 291

Human    97 VMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRC---------QTKLHPLRSA 152
            : |.....||:| ||:..:.:..|...::..|......|....|:|         ..:.:..|:.
Zfish   292 I-YGRSVSTQSS-TAVYLIVKASPRSTVTVTPDSAVFTGETFNLKCVIESDHSDWTYEWYADRNR 354

Human   153 LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRP 217
            ::|    ..|||...:|   ..|.|.||.|.|.|.|||:...:|..|..|...:.:.|:....:|
Zfish   355 VKL----QSDGHYTVNR---DTLTIRGAAESDQGQYWCKGFIDGRSVSTQPTSVYLTVKDLKPKP 412

Human   218 VLTLHHGPADPAV-GDMV--------------------------------------------QLL 237
              .|...||.||: |:.|                                            |..
Zfish   413 --ELRSDPAGPALTGNTVTLTCNTDLSTGWDFYWYKNTQESEIKTTRTNSYSMKIDSLSDGGQYW 475

Human   238 CEAQRGSPPILYSFYLDEKIVGNHSAP---------------------C----GGTTSLLFPVKS 277
            |.|.||. |:.|:.|.||..:....:|                     |    ||.|...:..:.
Zfish   476 CRAGRGE-PVYYTQYSDELTLSVTESPKAVAIIQPDERVFRGETVTLRCDIKWGGNTEWTYRWEI 539

Human   278 EQ----------------------------------DAGNYSCEAE-NSVSRERSEPKKLSLKGS 307
            ||                                  ..|||||..: |:...:||:|..|::...
Zfish   540 EQTDHYNKYYNQYNQHKNNVSRCSAQELKISLVEVFHRGNYSCTGQMNTQISQRSDPVALTVYSD 604

Human   308 Q----VLFTPASNWLVPWL 322
            :    |..:|.     |||
Zfish   605 EAQAAVQVSPQ-----PWL 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCRL6XP_005245185.1 Ig2_FcgammaR_like 29..108 CDD:143230 23/75 (31%)
Ig_2 122..210 CDD:290606 23/96 (24%)
IG_like 133..208 CDD:214653 22/83 (27%)
Ig_3 216..290 CDD:290638 30/178 (17%)
si:dkey-23a13.11XP_021333780.1 Ig_3 41..115 CDD:316449
IGc2 234..288 CDD:197706 14/55 (25%)
Ig_3 316..386 CDD:316449 19/76 (25%)
IG_like 425..497 CDD:214653 12/72 (17%)
Ig_2 509..601 CDD:316418 16/91 (18%)
Ig_3 610..677 CDD:316449 5/14 (36%)
Ig 785..>847 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11481
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.