DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44153 and bdl

DIOPT Version :9

Sequence 1:NP_001097136.2 Gene:CG44153 / 34341 FlyBaseID:FBgn0265002 Length:1946 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:565 Identity:120/565 - (21%)
Similarity:189/565 - (33%) Gaps:151/565 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 PPLGLLELTVNQPQSGVREASEFIISCTAQGSSRMQFQWFKDGAVVNASKSTREIWTTVLPPETK 515
            ||       |||.   :||.......|..:.....|..|:|||               ||..|.:
  Fly   156 PP-------VNQT---IREGQTAFFHCVMKHPENSQASWYKDG---------------VLLQEVQ 195

  Fly   516 DVYTAI-------LGVTKASRIDEGVYSCKVTDW-GVEQCRSLHIHIKSPPRLRVDPASVTLQRG 572
            |:....       |.:......|.|.|.|||.:. |..|.....::|:...::...|..|.|..|
  Fly   196 DLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYG 260

  Fly   573 DSLRVRCLSPGNDDIKRYAQLGYSWTRNGVLFQSDAATAMWEDLYPDGSIL--KINNIQKSAEYA 635
            ....:.|....|..:|     ...|.::|:||.|.....::..:  :||:.  |::. ..:..|.
  Fly   261 QPAVLDCHFRANPPLK-----NLRWEKDGLLFDSYNVPGVFYKM--NGSLFFAKVDE-NHAGSYT 317

  Fly   636 CLVSNS--------------VRP-----VSRSVYINVIERNAVHVCPAESTYGVHWPT----SAP 677
            |...|.              :||     ..:::||..:...|...|.|....|.:.|:    ...
  Fly   318 CTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKD 382

  Fly   678 GSPI-------------ITDCPRGFEGHLKRICEQRDTGNSTWLLPDFSGCVRDELLLIYNRFLA 729
            |.|:             ||....|..|    |.|...|..:..:..:..       |:|.|  :|
  Fly   383 GQPLPADRFSLSGGNLTITGLVEGDRG----IYECSATNEAATITAEAE-------LMIEN--IA 434

  Fly   730 LSAGFQQTNSSNILKACFEFTLQRRHSFLPGEASFLIDMLHELDTYLQ--LKGTQLEREMAAE-- 790
            ..|.:..|  :|..:.|.....|      ||              ||:  |:.|...|.|.|.  
  Fly   435 PRAPYNLT--ANSTETCITIRWQ------PG--------------YLRPNLEYTVWYRLMEAPEW 477

  Fly   791 IILRILDKVMQNAQSLNSQQQIKKLQQLTQSAALNRETIAASQLATSTSGSSQPLPGDSSTRGDD 855
            ..||:|||.:..| ::...|..|:.:.:..|.....:.:.:.|....|      ||  |..|.||
  Fly   478 RTLRVLDKKVMEA-TVQHLQPGKEYEFMVLSQDKYGDGMFSKQFRFQT------LP--SPIRADD 533

  Fly   856 GSGSGV--TAGEMSAAPAGSLQATRAGGAGGGPGGASSILTVDEDTLSLDR----LNSLRIYMTS 914
            .....:  ..|::: ||||.|         |.|...::|.......|..:.    |..||:|...
  Fly   534 FDAQQLQHDLGQVT-APAGGL---------GAPWNLTAISNQQGWLLHWEHPVQGLEGLRLYAVR 588

  Fly   915 VKTLPFNLRIYGEDLFSDQLYMDIGLSSRLLHIMANSTIFASVIS 959
            ....|.:..|...:.| |..|       :|.|:..::.....|::
  Fly   589 WWKEPEHFLIGHAETF-DNYY-------QLRHLKEDTLFKVQVLA 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44153NP_001097136.2 EGF_CA <264..294 CDD:238011
IG_like 467..554 CDD:214653 21/94 (22%)
Ig 474..551 CDD:143165 19/84 (23%)
IG_like 564..653 CDD:214653 22/109 (20%)
Ig 572..642 CDD:299845 15/85 (18%)
HRM 661..718 CDD:280888 13/73 (18%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 26/110 (24%)
Ig 157..242 CDD:299845 25/109 (23%)
Ig_2 252..337 CDD:290606 18/92 (20%)
IG_like 260..327 CDD:214653 15/74 (20%)
I-set 341..428 CDD:254352 16/97 (16%)
IGc2 356..419 CDD:197706 14/66 (21%)
FN3 435..524 CDD:238020 24/111 (22%)
FN3 554..636 CDD:238020 16/80 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.