DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB11

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:385 Identity:92/385 - (23%)
Similarity:178/385 - (46%) Gaps:41/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLR-------LKQRFASNAKMA- 74
            ::..:.::....|:..|.|.|...||::.||:.|.|.|:|:|.|.       ||..|..:.|.: 
Human    15 VFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKPGFKDSPKCSQ 79

  Fly    75 -----NFYAAELGNIT-TDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ-TEK 132
                 :.:..|...|. .|::..|.:.|||..:........:...::.::.|..:.||.|| ||:
Human    80 AGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEKWYQARLQTVDFEQSTEE 144

  Fly   133 LRRHISEQILASVGGGSWKDIHVAGGSS---ANTLLLLLAANLQSKWFLPFSAYRT--GLYEFHS 192
            .|:.|:..:.....|   |..::.|.|:   ::.::|:.|...:.:|...|....|  ..::...
Human   145 TRKTINAWVENKTNG---KVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKFQVRETVKSPFQLSE 206

  Fly   193 GSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDL 257
            |..| :|.|::....| |.|.:::...:.:||||.: .:|||:::||.....|:::||||:.   
Human   207 GKNV-TVEMMYQIGTF-KLAFVKEPQMQVLELPYVN-NKLSMIILLPVGIANLKQIEKQLNS--- 265

  Fly   258 GALQQ-----RMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIAD 316
            |...:     .|....|:|.||:|.::.:..|...||.||..::| ...|:...:..:..|.::.
Human   266 GTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGMSPTKGLYLSK 330

  Fly   317 VLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            .:.|..::::|.|:.:.      |.....|.:.:...:..|:|:|||.|.||..:...::
Human   331 AIHKSYLDVSEEGTEAA------AATGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNTIL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 92/385 (24%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 92/385 (24%)
RCL. /evidence=ECO:0000250 341..365 4/29 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.