DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB7

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001035237.1 Gene:SERPINB7 / 8710 HGNCID:13902 Length:380 Species:Homo sapiens


Alignment Length:363 Identity:94/363 - (25%)
Similarity:167/363 - (46%) Gaps:25/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK--QRFASNAKMANFYAAELGNITTD----- 87
            ||..|.|.|.|.|:|:.||:...:..::.|.|.:.  ..:.:::...:...::|..:.:|     
Human    27 NVFFSSLSLFAALALVRLGAQDDSLSQIDKLLHVNTASGYGNSSNSQSGLQSQLKRVFSDINASH 91

  Fly    88 ADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGGSWK 151
            .|..|.:.|.|......|...|:.:.|:..:.|..|.||. ...|..||:|::.: .:...|..|
Human    92 KDYDLSIVNGLFAEKVYGFHKDYIECAEKLYDAKVERVDFTNHLEDTRRNINKWV-ENETHGKIK 155

  Fly   152 DIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGS-QVKSVPMLFDDDMFVKFAEL 214
            ::...||.|::.:::|: |...:.||...|:...|....|.|.. ..|:|.|:..:..| ..:.:
Human   156 NVIGEGGISSSAVMVLVNAVYFKGKWQSAFTKSETINCHFKSPKCSGKAVAMMHQERKF-NLSVI 219

  Fly   215 RDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRMQMEGVQVLLPKFS 277
            .|...:.:||.|...  ::|.::||  ...|.|:|.:|  .:|......:||..:.|:|..|:|.
Human   220 EDPSMKILELRYNGG--INMYVLLP--ENDLSEIENKLTFQNLMEWTNPRRMTSKYVEVFFPQFK 280

  Fly   278 IDFECSLRQPLKQLGFEEIFAAS-ANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNAT 341
            |:....::|.|:.||.::||..| |:...:.:...|.|:.::.|..|.:.|.|:.:......|  
Human   281 IEKNYEMKQYLRALGLKDIFDESKADLSGIASGGRLYISRMMHKSYIEVTEEGTEATAATGSN-- 343

  Fly   342 EYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHV 379
                ||.....:...|||||||.|.||.:::....|.|
Human   344 ----IVEKQLPQSTLFRADHPFLFVIRKDDIILFSGKV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/361 (26%)
SERPINB7NP_001035237.1 serpinB7_megsin 1..380 CDD:381032 94/363 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.