DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SRP3

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_176586.1 Gene:SRP3 / 842706 AraportID:AT1G64030 Length:385 Species:Arabidopsis thaliana


Alignment Length:399 Identity:88/399 - (22%)
Similarity:152/399 - (38%) Gaps:109/399 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HSIATSFAEQNVVVSPLLLEATLSLLFLGSDG-ATAEELQKQLR------LKQRFASNAKMANFY 77
            |.::::..:.||:.||..:.:.:::...|..| ..:.::...||      ||..|...|.:.  |
plant    20 HVLSSAPKDSNVIFSPASINSAITMHAAGPGGDLVSGQILSFLRSSSIDELKTVFRELASVV--Y 82

  Fly    78 A---AELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHIS 138
            |   |..|...|.|       |.|.:.........|:.:.:.:|.|....||. .:.|::|:.::
plant    83 ADRSATGGPKITAA-------NGLWIDKSLPTDPKFKDLFENFFKAVYVPVDFRSEAEEVRKEVN 140

  Fly   139 EQILASVGGGSWKDIH--------VAGGS--SANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-- 191
                      ||.:.|        :..||  |....:...|.:.:..|..||..|.|...:|:  
plant   141 ----------SWVEHHTNNLIKDLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLV 195

  Fly   192 SGSQVKSVPMLFD-DDMFVKFAELRDLDA-RAIELPYEHAEE-----LSMLLILPNQRGGLQELE 249
            :|:.| |||.:.. ::.:|     |..|. :.:.|||:...:     .||...||:::.||.:|.
plant   196 NGTSV-SVPFMSSYENQYV-----RAYDGFKVLRLPYQRGSDDTNRKFSMYFYLPDKKDGLDDLL 254

  Fly   250 KQLHD----LDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASA 310
            :::..    ||......|.::|..::  |||.|:|..|:...|.:||...:              
plant   255 EKMASTPGFLDSHIPTYRDELEKFRI--PKFKIEFGFSVTSVLDRLGLRSM-------------- 303

  Fly   311 NLPIADVLQKLRINLNESGSGSGP--------------ELPKNATEYKPIVISNSSRQKFFRADH 361
                 .:..|..:.::|.|:.:..              |.||...               |.|||
plant   304 -----SMYHKACVEIDEEGAEAAAATADGDCGCSLDFVEPPKKID---------------FVADH 348

  Fly   362 PFFFAIRSE 370
            ||.|.||.|
plant   349 PFLFLIREE 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 88/399 (22%)
SRP3NP_176586.1 serpinP_plants 8..371 CDD:381001 88/399 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.