DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and AT1G62170

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001185292.1 Gene:AT1G62170 / 842513 AraportID:AT1G62170 Length:466 Species:Arabidopsis thaliana


Alignment Length:416 Identity:91/416 - (21%)
Similarity:152/416 - (36%) Gaps:115/416 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNI-- 84
            |::.....|.|.||..:.|.|:::...|.|...|||:..: |....:|:....|....|:.::  
plant    83 ISSVAKNSNFVFSPASINAALTMVAASSGGEQGEELRSFI-LSFLKSSSTDELNAIFREIASVVL 146

  Fly    85 ---TTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ----TEKLRR------- 135
               :......:.:.|.:.:.....|....:.:.:.:|.|....||...    ..||..       
plant   147 VDGSKKGGPKIAVVNGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKCNVLNKLGLAVSLLES 211

  Fly   136 --HIS-------------EQILASVGGGSWKDIHVAG--------GSSANTLLLLLAANLQSK-- 175
              |||             |::...|  .:|...|..|        ||..:....:..:.|..|  
plant   212 IFHISTLFDFKFALIRSAEEVRTEV--NAWASSHTNGLIKDLLPRGSVTSLTDRVYGSALYFKGT 274

  Fly   176 WFLPFSAYRTGLYEFH--SGSQVKSVPMLFDDDMFVKFAELRDLDA----RAIELPYEHAEE--- 231
            |...:|...|....|:  :|:.| |||       |:...|.:.:.|    :.:.|||....:   
plant   275 WEEKYSKSMTKCKPFYLLNGTSV-SVP-------FMSSFEKQYIAAYDGFKVLRLPYRQGRDNTN 331

  Fly   232 --LSMLLILPNQRGGLQELEKQLHD----LDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQ 290
              .:|.:.||:::|.|.:|.:::..    ||....::|:::...::  |||.|:|          
plant   332 RNFAMYIYLPDKKGELDDLLERMTSTPGFLDSHNPERRVKVGKFRI--PKFKIEF---------- 384

  Fly   291 LGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGS-----------GPELPKNATEYK 344
             |||    ||:.|.......:.     .||..|.::|.|:.:           |..|      .|
plant   385 -GFE----ASSAFSDFELDVSF-----YQKTLIEIDEKGTEAVTFTAFRSAYLGCAL------VK 433

  Fly   345 PIVISNSSRQKFFRADHPFFFAIRSE 370
            ||         .|.|||||.|.||.|
plant   434 PI---------DFVADHPFLFLIREE 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/416 (22%)
AT1G62170NP_001185292.1 SERPIN 69..464 CDD:294093 91/416 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.