DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpind1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:379 Identity:89/379 - (23%)
Similarity:158/379 - (41%) Gaps:52/379 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITTD 87
            |||  ..|:.::|:.:...:.::.||..|.|.||:...|..|....:::|.         .:||.
  Rat   125 ATS--SDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKY---------EVTTI 178

  Fly    88 ADTF---------------LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ---TEKLR 134
            .:.|               ||..|.|.:..:..:.:||:...:.::.|.|:..|...   ..|..
  Rat   179 HNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPAFISKAN 243

  Fly   135 RHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKS 198
            .||     ..:..|..|:. :....||..:::|.....:..|...|....|..:.|. :..:|..
  Rat   244 SHI-----LKLTKGLIKEA-LENTDSATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVVK 302

  Fly   199 VPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQR 263
            |.|:.....|:. |..::||...::|  |:...:|||:::|.:..|::.||.||....:...|:.
  Rat   303 VSMMQTKGNFLA-ANDQELDCDILQL--EYVGGISMLIVIPRKLSGMKTLEAQLTPQVVERWQKS 364

  Fly   264 MQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQ-KLRINLNE 327
            |.....:||||||.::...:|.:.||.:|..::|..:.|...:  |....|.|:.: :..|.:||
  Rat   365 MTNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGI--SDQRIIIDLFKHQSTITVNE 427

  Fly   328 SGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYL--MGHV 379
            .|:.:.   ......:.|:     |.|..|..|.||.|.:.....:.|  ||.|
  Rat   428 EGTQAA---AVTTVGFMPL-----STQVRFTVDRPFLFLVYEHRTSCLLFMGRV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 88/377 (23%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 89/379 (23%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.