DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina9

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001348839.1 Gene:Serpina9 / 71907 MGIID:1919157 Length:418 Species:Mus musculus


Alignment Length:384 Identity:80/384 - (20%)
Similarity:159/384 - (41%) Gaps:29/384 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFA 68
            |:..:|.:......:|..:|.....||::.||:.:..:|::|.||:..||..::.:.|.....:.
Mouse    43 ASQVSPSNTRFSFLLYQRLAQENPGQNILFSPVSISTSLAMLSLGARSATKTQILRTLGFNFTWV 107

  Fly    69 SNAKM---ANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQT 130
            |...:   ..:....|.......:  |::.:.|.:..|..:...|....:..:.|.....|....
Mouse   108 SEPTIHMGFEYLVRSLNKCHQGRE--LRMGSVLFIRKELQLQATFLDRVKKLYGAKVFSEDFSNA 170

  Fly   131 EKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPFSAYRTGL---YE 189
            ...:..|:..:.....|   |.:.|.....:.|.::|:  |   .::.|..|||...|..   :.
Mouse   171 ATAQAQINSYVEKETKG---KVVDVIQDLDSQTAMVLV--NHIFFKANWTQPFSTANTNKSFPFL 230

  Fly   190 FHSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHD 254
            ...|:.| .|||:...:.|. |...::|....:::.|.  .:.....:||. :|.:::|||.|..
Mouse   231 LSKGTTV-HVPMMHQTESFA-FGVDKELGCSILQMDYR--GDAVAFFVLPG-KGKMRQLEKSLSA 290

  Fly   255 LDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQ 319
            ..|....:.:|...::|.:|||||....:|...|.::|..:.|.::|:|..:..:..|.::....
Mouse   291 RRLRKWSRSLQKRWIKVFIPKFSISASYNLETILPKMGIRDAFNSNADFSGITKTHFLQVSKAAH 355

  Fly   320 KLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAI---RSENVTYL 375
            |..::::|.|:.:..     ||..|.||.|..:.........||...:   .:|:|.:|
Mouse   356 KAVLDVSEEGTEAAA-----ATTTKLIVRSRDTPSSIIAFKEPFLILLLDKNTESVLFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 78/370 (21%)
Serpina9NP_001348839.1 alpha-1-antitrypsin_like 49..412 CDD:239011 78/378 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.