DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb12

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001186142.1 Gene:Serpinb12 / 71869 MGIID:1919119 Length:423 Species:Mus musculus


Alignment Length:421 Identity:96/421 - (22%)
Similarity:181/421 - (42%) Gaps:70/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEAANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL-- 63
            ::.|.|...:|      .:..|:...|.:|:.|.||.|.|...::.||:.|.:|.::.:.|..  
Mouse     4 LTAANNKFCFD------FFREISKDDAHKNIFVCPLSLSAAFGMVRLGARGDSAHQIDEALHFNE 62

  Fly    64 ----------------------------KQRFASNAKMAN----------FYAAELGNITTDADT 90
                                        ||..||..:...          .:...|..|..|...
Mouse    63 LSKDEHKEPNDPSPQSESKASDSSLEGQKQTSASQDQQGESTNDHQLLGCHFGKLLSRIDRDKSY 127

  Fly    91 F-LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ-TEKLRRHISEQILASVGGGSWKDI 153
            : |.:.|||....|..:..::......:||.|.|.||.:: :||.|:.|:..: .|...|..|::
Mouse   128 YTLSMANRLYGEQEFPICSEYSDDVTEFFHTTVESVDFQKDSEKSRQEINFWV-ESQSQGKIKEL 191

  Fly   154 HVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEF-HSGSQVKSVPMLFDDDMFVKFAELRD 216
            ........:|:|:|: |...::||...|::..|....| .:.::.|:|.|:.....| :...:.:
Mouse   192 FGKEAIDNSTVLVLVNAVYFKAKWEREFNSENTVDASFCLNENEKKTVKMMNQKGKF-RIGFIDE 255

  Fly   217 LDARAIELPYEHAEELSMLLILP----NQRGGLQELEKQLHDLDLGA--LQQRMQMEGVQVLLPK 275
            |.|:.:|:.|... :||||::||    :....||||||:::...|.|  ..:.:..:.|.:..|:
Mouse   256 LQAQILEMKYAMG-KLSMLVLLPSCSEDNVNSLQELEKKINHEKLLAWSSSENLSEKPVAISFPQ 319

  Fly   276 FSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKN 339
            |:::....|:..|:.:|.:::| ...|:...:..|.||.::.::.|..:.::|.|:        .
Mouse   320 FNLEDSYDLKSILQDMGIKDVFDETKADLTGISKSPNLYLSKIVHKTFVEVDEMGT--------Q 376

  Fly   340 ATEYKPIVISNSSRQKF--FRADHPFFFAIR 368
            |.....:|.:..:...:  |.|:|||.|.||
Mouse   377 AAAASGVVAAEKALPSWVEFNANHPFLFFIR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/404 (23%)
Serpinb12NP_001186142.1 SERPIN 4..423 CDD:294093 96/421 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..106 4/42 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.