DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpine3

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:391 Identity:85/391 - (21%)
Similarity:152/391 - (38%) Gaps:38/391 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAK 72
            |.:..|    :|.|.|......|.|:||..:..:|.:|...:.|.|..:|.:.|....:.....:
  Rat    33 TEFALH----LYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYTVQDPRVRE 93

  Fly    73 MANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHI 137
            ..:.....|.|  :.....::|...|.:.:.:.::..|.:....:.:::.|..|..:........
  Rat    94 FLHTVYITLHN--SSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPNTTTMEA 156

  Fly   138 SE-QILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWF----------LPFSAYRTGLYEFH 191
            |: ....|.|.|....:....|:.:..|.::.....||.|.          |||:.....:.:..
  Rat   157 SKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGLVLQVP 221

  Fly   192 SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRG-GLQELEKQLHDL 255
            :..||..|       .:.:|.:........:||.| .....|:||:||..:| .|..:|..|...
  Rat   222 AMHQVAEV-------SYGQFQDAAGHKVDVLELLY-LGRVASLLLVLPQDKGTPLDHIEPHLTAR 278

  Fly   256 DLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQ 319
            .:.....|::...:.|.||:|.|..:..|:..|:..|..::| ...||.|.:.......:::|..
  Rat   279 VIHLWTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGISGRDGFYVSEVTH 343

  Fly   320 KLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSEN---VTYLMGHVVE 381
            |.::.|:|.|:.|..     ||   .:::...||...|:||.||.|.:|..|   |....|.|..
  Rat   344 KAKMELSEEGTKSCA-----AT---AVLLLRRSRTPAFKADRPFIFLLREHNTVAVRITHGKVAN 400

  Fly   382 F 382
            |
  Rat   401 F 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 81/376 (22%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 84/388 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.