DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA7

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:419 Identity:86/419 - (20%)
Similarity:158/419 - (37%) Gaps:70/419 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAANPTPY-----DCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQL 61
            |...|.|.|     :......:|........::|:..||:.:.|.|.:|..|:..:|..|:.:.|
Human    32 SSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETL 96

  Fly    62 ----------RLKQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQT 116
                      .::..|.......||...||.         ||:.|.|.:.........|....:|
Human    97 GFNLTDTPMVEIQHGFQHLICSLNFPKKELE---------LQIGNALFIGKHLKPLAKFLNDVKT 152

  Fly   117 YFHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPF 180
            .:.......|.......::.|:..:.....|   |.:.:......||:::|: ..:.:::|..||
Human   153 LYETEVFSTDFSNISAAKQEINSHVEMQTKG---KVVGLIQDLKPNTIMVLVNYIHFKAQWANPF 214

  Fly   181 SAYRTGLYEFHSG-----SQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPN 240
            ...:|   |..|.     :....|||:...:   ::..|.|::.....|..::::....|.:||.
Human   215 DPSKT---EDSSSFLIDKTTTVQVPMMHQME---QYYHLVDMELNCTVLQMDYSKNALALFVLPK 273

  Fly   241 QRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKH 305
            : |.::.:|..:....|....:.:|...|.:.:|||||.....|...|.::|.:..::.:|:|..
Human   274 E-GQMESVEAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSG 337

  Fly   306 LHAS-----ANLPIADVL-----QKLRINLNESGSGSG--PEL-----PKNATEYKPIVISNSSR 353
            |...     :|.|...||     .|..:::.|.|:.:.  ||:     |:| |...||:      
Human   338 LTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEAAAVPEVELSDQPEN-TFLHPII------ 395

  Fly   354 QKFFRADHPFFFAI--RSENVTYLMGHVV 380
                :.|..|...|  ||......:|.||
Human   396 ----QIDRSFMLLILERSTRSILFLGKVV 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 80/395 (20%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 80/402 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.