DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina1f

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:379 Identity:74/379 - (19%)
Similarity:163/379 - (43%) Gaps:30/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANF 76
            |::...::..:|......|::.||:.:.|.:|:|.|||:|..::.:.:.||..:.....|::...
Mouse    49 CNVSITLFKKMAQLSGNGNILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPEAEIHKC 113

  Fly    77 YAAELGNI-TTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQ 140
            :...|.:| .|:..:.||..:.:.:..:....|.|.|..:..:|:....::...:.:.:..|:..
Mouse   114 FWYLLHSIHQTEEPSSLQTGSSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNY 178

  Fly   141 ILASVGGGSWKDI-HVAGGSSANTLL-----LLLAANLQSKWFLPFSAYRTGLYEFHSG-SQVKS 198
            ::..    |.|:| ::.....::|.|     ::..|.|.|.    |......:.::|.| .....
Mouse   179 VMEK----SQKEIVNIVKNLESDTFLAVVNYIIWNAKLDSN----FGCRSVKVKDYHLGYGMTIK 235

  Fly   199 VPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQR 263
            |||:.:..|...| .:.||.:..:.|.. .....:...|:|:. |.:|::|:.|.......::::
Mouse   236 VPMIHNMAMHYLF-RVEDLSSTVLMLTL-LTGNFATYFIIPDP-GKMQKVEQSLTYPHFRRMRRQ 297

  Fly   264 MQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNES 328
            :....|.:.:|:.|:.....|...:..||...:|.:..|...::.:..... .|:.|..:.::|.
Mouse   298 LLTRLVDLEIPELSLSETHDLESMMSLLGITYVFNSGTNSSDMNDTLQKSF-KVVSKAVLTIDEK 361

  Fly   329 GSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR--SENVTYLMGHVV 380
            ||     .|...:.:|.:..::..|.:..|   ||...|:  :.:|...:|.||
Mouse   362 GS-----KPSTNSCFKKLGSTDMGRMQLNR---PFLIFIQDHTNDVPLFLGRVV 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 71/370 (19%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 74/379 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.