DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpini2

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_080736.2 Gene:Serpini2 / 67931 MGIID:1915181 Length:405 Species:Mus musculus


Alignment Length:400 Identity:102/400 - (25%)
Similarity:175/400 - (43%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL------------------- 63
            :|.:|:.|. :.|::.|||.....|.::.||:.|...:::.|.||:                   
Mouse    33 LYKAISLSH-KNNIIFSPLGTTMLLGMVQLGAKGKAQQQILKTLRMRGTPAGEEFSVLKSLFSAI 96

  Fly    64 ---KQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECV 125
               ||.|..|...| .|..| |.|.  .:|:|. .|:....|.:.:.|...  |:|...|.:..|
Mouse    97 SKKKQEFTFNLASA-LYLQE-GFIV--KETYLH-SNKEFFQSATKLVDFLD--AKTSAQAISTWV 154

  Fly   126 DLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEF 190
            :.:...|::...||:....:                ..|:|:.|...:..|...|....|.:.:|
Mouse   155 ESKTDGKIKNMFSEEEFGPL----------------TRLVLVNAIYFKGDWKQKFRKEDTEMTDF 203

  Fly   191 --HSGSQVKSVPMLFDDDMFVKFAELR---------DLDARAIELPYEHAEELSMLLILPNQRGG 244
              ..||.|| |||:        .|.||         .:..:.:||||: |:|.|:::|||.:...
Mouse   204 TKKDGSTVK-VPMM--------KALLRAQYGYFSQSSMTCQVLELPYK-ADEFSLVIILPTEDTS 258

  Fly   245 LQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHAS 309
            ::|:|.|:....:......:..|.|:|.||:|.|:.:..|::.|..|...|||:...:...:..|
Mouse   259 IEEVENQVTAPHVRRWFSELHEEEVEVSLPRFKIEQKLDLKEALYSLNVTEIFSGGCDLSGITDS 323

  Fly   310 ANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFA---IRSEN 371
            :.:.::.|:||:...:||.||.:......|.    |.::|.:..|  |.|:|||.|.   ||:|:
Mouse   324 SEVYVSRVMQKVFFEINEDGSEAAASTGINI----PAIMSLTQTQ--FLANHPFLFILKHIRTES 382

  Fly   372 VTYLMGHVVE 381
            :.: ||.|.:
Mouse   383 ILF-MGKVTD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/396 (26%)
Serpini2NP_080736.2 neuroserpin 23..405 CDD:239003 102/399 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.120

Return to query results.
Submit another query.