DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB3

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_008850.1 Gene:SERPINB3 / 6317 HGNCID:10569 Length:390 Species:Homo sapiens


Alignment Length:399 Identity:99/399 - (24%)
Similarity:179/399 - (44%) Gaps:43/399 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEAANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQ 65
            :|||.....:|      ::.....| .|.|:..||:.:.:.|.::.||:...||::::|.|...|
Human     4 LSEANTKFMFD------LFQQFRKS-KENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQ 61

  Fly    66 -RFASNAKMANFYAAELGNI-------------TTDADTFLQLQNRLMLSSESGVADDFQKIAQT 116
             ...:..|.|.::....||:             :|||.. |::.|:|..........::....:.
Human    62 VTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYE-LKIANKLFGEKTYLFLQEYLDAIKK 125

  Fly   117 YFHATAECVDL-----EQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSK 175
            ::..:.|.||.     |..:|:...:..|....:     |::...|...:||.|:|: |...:.:
Human   126 FYQTSVESVDFANAPEESRKKINSWVESQTNEKI-----KNLIPEGNIGSNTTLVLVNAIYFKGQ 185

  Fly   176 WFLPFSAYRTGLYEFHSGSQV-KSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILP 239
            |...|:...|...:|...... ||:.|:.....| .||.|.|:.|:.:|:||: .::|||:::||
Human   186 WEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSF-HFASLEDVQAKVLEIPYK-GKDLSMIVLLP 248

  Fly   240 NQRGGLQELEKQL--HDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASAN 302
            |:..|||:||::|  ..|......|.|:...|.:.||:|.::....|:..|:.:|..:||...|:
Human   249 NEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDAD 313

  Fly   303 FKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAI 367
            ...:..|..|.::.||.|..:.:.|.|:.:..     ||.......|.:|..:.|..:|||.|.|
Human   314 LSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAA-----ATAVVGFGSSPTSTNEEFHCNHPFLFFI 373

  Fly   368 RSENVTYLM 376
            |......::
Human   374 RQNKTNSIL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 95/382 (25%)
SERPINB3NP_008850.1 serpinB3_B4_SCCA1_2 1..390 CDD:381030 99/399 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.