DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb9h

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001357856.1 Gene:Serpinb9h / 544923 MGIID:3709608 Length:377 Species:Mus musculus


Alignment Length:357 Identity:82/357 - (22%)
Similarity:156/357 - (43%) Gaps:40/357 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK---------QRFASNAKMANFYAAELGNI 84
            :||..||:.:.:.|:::.||:.|.||.::.:.|.|.         |....|....|         
Mouse    26 KNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNPDEDVHQGFQLLLHNLNKQN--------- 81

  Fly    85 TTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGG 148
              :....|.:.|||.:.:...:...|::....::|:..|.:.. |..|:.|:||:..:.....| 
Mouse    82 --NQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVSKQTNG- 143

  Fly   149 SWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLF-DDDMF 208
              |...:....|.|:...|:.||   ....|...|...||....|. :..:.:.|.|:: :|.:|
Mouse   144 --KIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWREDTLF 206

  Fly   209 VKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRMQMEGVQV 271
              .|.::::.|:.:.:||| ..:|:.:::||::...:.::|..|  ..|......:.|......|
Mouse   207 --HAYVKEIQAQVLVMPYE-GIDLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHV 268

  Fly   272 LLPKFSIDFECSLRQPLKQLGFEEIFAAS-ANFKHLHASANLPIADVLQKLRINLNESGSGSGPE 335
            ..|||.:..:..:...|:.||...:|..| |:...:....||.:::.:.|..:.:||.|:.:.  
Mouse   269 YYPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAA-- 331

  Fly   336 LPKNATEYKPIVISNSSRQKFFRADHPFFFAI 367
             ..:|.|:  |.:.:....:.|.|||||.|.|
Mouse   332 -AASAVEF--IFLCSGPDPETFCADHPFLFFI 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 82/357 (23%)
Serpinb9hNP_001357856.1 serpinB 7..374 CDD:381072 82/357 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.