DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB13

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001294852.1 Gene:SERPINB13 / 5275 HGNCID:8944 Length:400 Species:Homo sapiens


Alignment Length:400 Identity:92/400 - (23%)
Similarity:163/400 - (40%) Gaps:102/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQ---------KQLRLK--------------------- 64
            |:..||:.:...:.::.||:.||||.:|:         |..|:|                     
Human    26 NIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVVRIKAEGKEIENTEA 90

  Fly    65 -----QRFASN-AKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAE 123
                 |:|.:. :|:.|.|...:.|......|:|.||..|          |:   .:.|:||:.|
Human    91 VHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYL----------DY---VEKYYHASLE 142

  Fly   124 CVD-LEQTEKLRRHISEQILASVGGGSW---------KDIHVAGGSSANTLLLLL-AANLQSKWF 177
            .|| :...::.|:.|:          ||         ||:...|..|::|.|:|: ....:.:|.
Human   143 PVDFVNAADESRKKIN----------SWVESKTNEKIKDLFPDGSISSSTKLVLVNMVYFKGQWD 197

  Fly   178 LPFSAYRTGLYEF-HSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQ 241
            ..|....|...:| .:.|..|||.|:.....| .|..|.||.|:.:.:||:: .:|||.::|||.
Human   198 REFKKENTKEEKFWMNKSTSKSVQMMTQSHSF-SFTFLEDLQAKILGIPYKN-NDLSMFVLLPND 260

  Fly   242 RGGLQEL------EKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAA- 299
            ..||:::      ||.:.....|.:::|.    |.:.||:|.::....|...|..:|..:.|:. 
Human   261 IDGLEKIIDKISPEKLVEWTSPGHMEERK----VNLHLPRFEVEDGYDLEAVLAAMGMGDAFSEH 321

  Fly   300 SANFKHLHASANLPIADVLQKLRINLNESG------SGSGPELPKNATEYKPIVISNSSRQKFFR 358
            .|::..:.:.:.|.....|....:.:.|.|      :|.|            ..::::...:...
Human   322 KADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIG------------FTVTSAPGHENVH 374

  Fly   359 ADHPFFFAIR 368
            .:|||.|.||
Human   375 CNHPFLFFIR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/399 (23%)
SERPINB13NP_001294852.1 SERPIN 4..400 CDD:294093 91/399 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.