DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB6

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:393 Identity:95/393 - (24%)
Similarity:167/393 - (42%) Gaps:64/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HIGAGIYHSIAT---SFA-----------EQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLR- 62
            ||.:.|...:|.   :||           .:||..||:.:...|:::::|:.|.||.::.:.|. 
Human    73 HIKSAIMDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSF 137

  Fly    63 --------LKQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFH 119
                    :.|.|.|.....|         .|.....|::.|||...........|:...|.::.
Human   138 NKSGGGGDIHQGFQSLLTEVN---------KTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQ 193

  Fly   120 ATAECVD-LEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAY 183
            |..|.:| :...||.|:||:..:.....|...:.:..........|:|:.|...:..|...|...
Human   194 AEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE 258

  Fly   184 RTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQE 247
            .|....|. |.::.|.|.|:|....|.| ..:.::..:.:.|||. .:||:|:::||::...|:.
Human   259 NTEERLFKVSKNEEKPVQMMFKQSTFKK-TYIGEIFTQILVLPYV-GKELNMIIMLPDETTDLRT 321

  Fly   248 LEKQL--------HDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANF 303
            :||:|        ..||:      |..|.|:|.||:|.::....:...|:.||..:.| ...|:|
Human   322 VEKELTYEKFVEWTRLDM------MDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADF 380

  Fly   304 KHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKF---FRADHPFFF 365
            ..: :..:|.::.|:.|..:.:||.|:       :.|.....|::...:|  |   |.|||||.|
Human   381 SGM-SQTDLSLSKVVHKSFVEVNEEGT-------EAAAATAAIMMMRCAR--FVPRFCADHPFLF 435

  Fly   366 AIR 368
            .|:
Human   436 FIQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/388 (24%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 92/384 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.