DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINB5

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_002630.2 Gene:SERPINB5 / 5268 HGNCID:8949 Length:375 Species:Homo sapiens


Alignment Length:377 Identity:91/377 - (24%)
Similarity:171/377 - (45%) Gaps:67/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLK---------QRFASNA-KMANFYAAELGNI 84
            ||:.||:.|..:|||..:|:.|.||.|:.:.|..:         |...|:. |:::||:      
Human    27 NVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYS------ 85

  Fly    85 TTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGG 148
                   |:|..||.:.....::.:|....:..:....|.||. ::.|:.:..|:..|       
Human    86 -------LKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVDFKDKLEETKGQINNSI------- 136

  Fly   149 SWKDI------HVAGGSSAN---TLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLF 203
              ||:      ::...:|.|   .:|::.||....||...||...|....|. :.:..|.|.|:.
Human   137 --KDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESETKECPFRVNKTDTKPVQMMN 199

  Fly   204 DDDMFVKFAELRDLDARAIELPYEHAEELSMLLILP----NQRGGLQELEKQLHDLDLGALQQRM 264
            .:..|. ...:..::.:.||||::: :.|||.::||    ::..||:::||||:...|.......
Human   200 MEATFC-MGNIDSINCKIIELPFQN-KHLSMFILLPKDVEDESTGLEKIEKQLNSESLSQWTNPS 262

  Fly   265 QMEGVQVLL--PKFSIDFECSLRQPLKQLGFEEIFAA-SANFKHLHASANLPIADVLQKLRINLN 326
            .|...:|.|  |||.::.....:..|:.||.:.||:. :::|..:..:..:.:::|:.|:.:.:.
Human   263 TMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSEDTSDFSGMSETKGVALSNVIHKVCLEIT 327

  Fly   327 ESGSGSGPELP-KNATEYKPIVISNSSRQKFFRADHPFFFAIR---SENVTY 374
            |.| |...|:| ....::|..:          .|||||.:.||   :.|:.:
Human   328 EDG-GDSIEVPGARILQHKDEL----------NADHPFIYIIRHNKTRNIIF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/377 (24%)
SERPINB5NP_002630.2 maspin_like 4..375 CDD:239012 91/377 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.