DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA4

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:395 Identity:85/395 - (21%)
Similarity:169/395 - (42%) Gaps:46/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKM 73
            |.:.......|:.||:....:|:..|||.:.|..::|.||:...:..::.:.|.......|.:.:
Human    90 PANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDV 154

  Fly    74 ANFYAAELGNIT-------TDADTFLQLQNRL-----MLSSESGVADDFQKIAQTYFHATAECVD 126
            ...:...|..:.       |...:.|.|.:.|     .|:....|.:  .|:..|.|:.|...:.
Human   155 HRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYE--AKLFHTNFYDTVGTIQ 217

  Fly   127 LEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEF 190
            |     :..|:.::....:       :.:......:.|::|: ....::.|..||.:.||...:|
Human   218 L-----INDHVKKETRGKI-------VDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDF 270

  Fly   191 H--SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLH 253
            :  ..:.|: |||:..|.....:...|.|....:.:.|:  .:.::..||||| |.::|:|:.|.
Human   271 YVDENTTVR-VPMMLQDQEHHWYLHDRYLPCSVLRMDYK--GDATVFFILPNQ-GKMREIEEVLT 331

  Fly   254 DLDL----GALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPI 314
            ...|    ..|::|...:.:::.||||||.....|.|.|.:|||.::|:..|:...:.....|..
Human   332 PEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEA 396

  Fly   315 ADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPF---FFAIRSENVTYLM 376
            :....|..::::|:|:.:..     ||.:.....|..:.:...|.:.||   .|:..:::|.:| 
Human   397 SKSFHKATLDVDEAGTEAAA-----ATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFL- 455

  Fly   377 GHVVE 381
            |.||:
Human   456 GKVVD 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 82/382 (21%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 82/390 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.