DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA10

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_016876842.1 Gene:SERPINA10 / 51156 HGNCID:15996 Length:484 Species:Homo sapiens


Alignment Length:383 Identity:93/383 - (24%)
Similarity:162/383 - (42%) Gaps:72/383 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLR------------------LKQRFASNAKMANF 76
            |:|.||..:...::.|.||:.|.|..::::.|.                  |::..:.|      
Human   137 NMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRN------ 195

  Fly    77 YAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-----EQTEKLRRH 136
              .||| :|..:..|:.        .:..|.:.|..:::.||  ..|||.:     .|.::|..|
Human   196 --LELG-LTQGSFAFIH--------KDFDVKETFFNLSKRYF--DTECVPMNFRNASQAKRLMNH 247

  Fly   137 -ISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANL-QSKWFLPFSAYRTGLYEFHSGS-QVKS 198
             |:::....:.       .:....:..|.|:|:...| :.||..||....|.:..||... :...
Human   248 YINKETRGKIP-------KLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIK 305

  Fly   199 VPMLFDDDMFVKFAELRDLDAR--AIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQ 261
            |||::...   |||...|.:.|  .::|||:  ...:||::|..:.|....||..|....:....
Human   306 VPMMYGAG---KFASTFDKNFRCHVLKLPYQ--GNATMLVVLMEKMGDHLALEDYLTTDLVETWL 365

  Fly   262 QRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASA-NLPIADVLQKLRINL 325
            :.|:...::|..|||.:|.:..:.:.|:|:|...||:..|:...|.|:. ||.::.|||:..|.:
Human   366 RNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEV 430

  Fly   326 NESGSGSGPELPKNATEYK-PIVISNSSRQKFFRADHPFFFAIRSE--NVTYLMGHVV 380
            :|.|:.:...:....|.|. |.||         :.|.||.|.|..|  .:...:|.||
Human   431 DERGTEAVAGILSEITAYSMPPVI---------KVDRPFHFMIYEETSGMLLFLGRVV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 91/380 (24%)
SERPINA10XP_016876842.1 PZI 114..478 CDD:239010 91/380 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.