DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA5

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:382 Identity:86/382 - (22%)
Similarity:176/382 - (46%) Gaps:31/382 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DCHIGA------------GIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL 63
            |.|:||            .:|.::|::...|::..||:.:..:|::|.||:..:|..::.:.|.|
Human    33 DLHVGATVAPSSRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGL 97

  Fly    64 KQRFASNAKMANFYAAELGNITTDADTF-LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL 127
            ..:.:|..::...:...|..:....|.| |.|.|.|.......:.|.|....:|.:.|.....:.
Human    98 NLQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNF 162

  Fly   128 EQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPFSAYRTGLYE 189
            ..:....:.|::.:.....|   |.:.:.....:|.:::::  |   .::||...|:...|...:
Human   163 RDSAGAMKQINDYVAKQTKG---KIVDLLKNLDSNAVVIMV--NYIFFKAKWETSFNHKGTQEQD 222

  Fly   190 FHSGSQ-VKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLH 253
            |:..|: |..|||:..:|.:....: |:|..|.:.:||:  ...:.|.|||:: |.:|::|..|.
Human   223 FYVTSETVVRVPMMSREDQYHYLLD-RNLSCRVVGVPYQ--GNATALFILPSE-GKMQQVENGLS 283

  Fly   254 DLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVL 318
            :..|....:..:...:::.||||||:....|.:.|..||...:|.:.|:...:...:|:.:::::
Human   284 EKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMV 348

  Fly   319 QKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYL 375
            .|..:.::|||:.:........| ::...: ||.|..|.|   ||...|...|:.:|
Human   349 HKAVVEVDESGTRAAAATGTIFT-FRSARL-NSQRLVFNR---PFLMFIVDNNILFL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 82/363 (23%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 82/371 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.