DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINE1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:428 Identity:111/428 - (25%)
Similarity:179/428 - (41%) Gaps:93/428 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAANPTPYDCHI----GAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLR 62
            |...:|..|..|:    |..::..:|.:..::|||.||..:.:.|::|.|.:.|.|.:::|..:.
Human    22 SAVHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMG 86

  Fly    63 LKQRFASNAKMA----NFYAAELGN------ITTDADTFLQLQNRLMLSSESGVADDFQKIAQTY 117
            .|   ..:..||    :.|...:|.      .|||| .|:|...:|:    .|....|.::    
Human    87 FK---IDDKGMAPALRHLYKELMGPWNKDEISTTDA-IFVQRDLKLV----QGFMPHFFRL---- 139

  Fly   118 FHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAG------GSSA----NTLLLLLAANL 172
            |.:|.:.||..:.|:.|..|::          |...|..|      |..|    ..|:|:.|...
Human   140 FRSTVKQVDFSEVERARFIIND----------WVKTHTKGMISNLLGKGAVDQLTRLVLVNALYF 194

  Fly   173 QSKWFLPFSAYRTGLYEFH--SGSQVKSVPMLFDDDMFVKFAELRDLDAR---AIELPYEHAEEL 232
            ..:|..||....|....||  .||.| ||||:...:.| .:.|....|..   .:|||| |.:.|
Human   195 NGQWKTPFPDSSTHRRLFHKSDGSTV-SVPMMAQTNKF-NYTEFTTPDGHYYDILELPY-HGDTL 256

  Fly   233 SMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQ------------VLLPKFSIDFECSLR 285
            ||.:..|.::           ::.|.||...:..:.:.            ::|||||::.|..||
Human   257 SMFIAAPYEK-----------EVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLR 310

  Fly   286 QPLKQLGFEEIFAA-SANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVIS 349
            :||:.||..::|.. .|:|..|.....|.:|..|||::|.:||||:        .|:....:::|
Human   311 KPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKIEVNESGT--------VASSSTAVIVS 367

  Fly   350 NSSRQKFFRADHPFFFAIR-------SENVTYLMGHVV 380
            .....:....|.||.|.:|       .:..|.|.|..|
Human   368 ARMAPEEIIMDRPFLFVVRHNPTGPLQDGTTGLTGAFV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 105/405 (26%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 105/407 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.