DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn28F

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:384 Identity:112/384 - (29%)
Similarity:183/384 - (47%) Gaps:32/384 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL---KQRFAS 69
            |...|......|..:|...|..|::.|||.:|..||:.::|:...||:|::..|:|   |:..|:
  Fly    11 TSVSCRFADDFYQLLAKENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVAA 75

  Fly    70 NAK--MANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEK 132
            ..|  ::.....|  .:.|     |.|.||:.::.:..:...:.::.:..|.|.||.:|:....|
  Fly    76 KYKDLLSKLEGRE--KVAT-----LSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVDPNK 133

  Fly   133 LRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFHSGSQVK 197
            ....::..: .:...|..||:..:...|...|::|.|...:.:|...|:...|....|....| |
  Fly   134 ASSIVNNWV-DNQTRGKIKDLVSSNDMSKMELIVLNAIYFKGQWEYKFNPKLTKKRNFRVSDQ-K 196

  Fly   198 SVPMLFDDDMFVKFAELR-----DLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDL 257
            |||:    :|...|...|     :|.|:.|||||.:: .||||:.||:|..||.||||::    :
  Fly   197 SVPV----EMMSLFQSFRAAHDSELGAKIIELPYRNS-SLSMLIFLPDQVDGLSELEKKI----V 252

  Fly   258 GALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLR 322
            |...:..:|: |.:.||||.|:|...|.:.|..:|.::.|..||:||.|..::|:.:..|:.|..
  Fly   253 GFKPKLSKMD-VTLRLPKFKIEFFAQLNKVLVAMGIQDAFEKSADFKDLVENSNVHVKKVIHKAF 316

  Fly   323 INLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVVE 381
            |.:||.|:.:..........|.   :...|.|..|.|||||.:.||.....|..||.|:
  Fly   317 IEVNEEGAEAAAATALLFVRYS---MPMPSSQMVFNADHPFAYVIRDRETIYFQGHFVK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 108/370 (29%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 109/377 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.