DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn42Da

DIOPT Version :10

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:60 Identity:19/60 - (31%)
Similarity:27/60 - (45%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SGPLPLTSVVLASSH--LKDSIFHNFDIDPSANMVAARLVSSDPDLSQRMFFHTVDIMDV 190
            ||.:|||:  |.|||  |.....:..|||     .|.|....|.|.::|..|:...:..:
  Fly   158 SGYIPLTA--LQSSHPRLPPPPVYGGDID-----AAWRPDPWDRDYNRRYRFNNTRVQHI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 serpin42Dd-like_insects 10..382 CDD:381070 19/60 (32%)
Spn42DaNP_524955.2 serpin42Da-like 45..407 CDD:381065 19/60 (32%)

Return to query results.
Submit another query.