DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpinb6

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001007932.1 Gene:serpinb6 / 493311 XenbaseID:XB-GENE-1001870 Length:379 Species:Xenopus tropicalis


Alignment Length:354 Identity:93/354 - (26%)
Similarity:167/354 - (47%) Gaps:34/354 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYA--AELGNITTDADTFL 92
            |:.||||.:.:.||::.||:.|.||.::.:.|:|.:  ..:|. .||.:  :|:....|  :..|
 Frog    27 NIFVSPLSISSALSMVLLGAKGNTATQMSQVLKLDK--VDDAH-CNFQSLISEINKSGT--NYLL 86

  Fly    93 QLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGGSWKDIHVA 156
            :..|||.........::|....|.::||..:.||. .:.|:.|..|:|.: |....|..||:..:
 Frog    87 RTANRLYGEKSYTFLEEFLGSTQKHYHADLKAVDFSRKAEESRGEINEWV-AQKTEGKIKDLLSS 150

  Fly   157 GG-SSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELRDLDA 219
            |. .|...|:|:.|...:..|...|:...|....|. :.::.|.|.|:|....| ....:.:|..
 Frog   151 GSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNETKPVQMMFKKAKF-PMTYIGELFT 214

  Fly   220 RAIELPYEHAEELSMLLILPNQ----RGGLQELEKQL-HDLDL-GALQQRMQMEGVQVLLPKFSI 278
            :.:|:||.. .||||:::||:.    ..||:.|||:| ::..| ....:.|.:..:::.||||.:
 Frog   215 KVVEIPYVD-NELSMIILLPDDINDGTTGLEALEKELTYEKFLKWTNPEMMDITEMELSLPKFKL 278

  Fly   279 DFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESG----SGSGPELPK 338
            :.:..|...|..:|..:.| ...|:|..:.::.:|.::.||.|..:::||.|    :.:...:..
 Frog   279 EDDYDLESFLSTMGMSDAFDQRRADFSGMSSANDLFLSKVLHKSFVDVNEEGTEAAAATAAIMML 343

  Fly   339 NATEYKPIVISNSSRQKFFRADHPFFFAI 367
            ......|.::          .||||.|.|
 Frog   344 RCAMIIPRIV----------CDHPFLFFI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 93/354 (26%)
serpinb6NP_001007932.1 PAI-2 4..379 CDD:239013 93/354 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.