DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINC1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens


Alignment Length:427 Identity:86/427 - (20%)
Similarity:165/427 - (38%) Gaps:88/427 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YHSIATSFAE-QNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            |..:|.|..: .|:.:|||.:....::..||:...|.::|.:..:........:...:|:.|:|.
Human    95 YQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLN 159

  Fly    83 -NITTDADTFLQL--QNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILA 143
             .:...|:...:|  .|||.........:.:|.|::..:.|..:.:|. |..|:.|..|::.:..
Human   160 CRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSN 224

  Fly   144 SVGGGSWKDIHVAGGSSANTLLLLLAAN------------------------------------- 171
            ...|   :...|....:.|.|.:|:..|                                     
Human   225 KTEG---RITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPER 286

  Fly   172 -------LQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEH 228
                   .|..|...||...|....|: :..:..|..|::.:..| ::..:.: ..:.:|||:: 
Human   287 ANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKF-RYRRVAE-GTQVLELPFK- 348

  Fly   229 AEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGF 293
            .::::|:||||.....|.::||:|....|......::...:.|.:|:|.|:...||::.|:.:|.
Human   349 GDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGL 413

  Fly   294 EEIFAASANFKHLHASANLP-----------IADVLQKLRINLNESGSGSGPELPKNATEYKPIV 347
            .::|:..        .:.||           ::|...|..:.:||.||        .|.....:|
Human   414 VDLFSPE--------KSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGS--------EAAASTAVV 462

  Fly   348 ISNSS---RQKFFRADHPFFFAIRSE--NVTYLMGHV 379
            |:..|   .:..|:|:.||...||..  |....||.|
Human   463 IAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRV 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 85/425 (20%)
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 86/427 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.