DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn27A

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:410 Identity:104/410 - (25%)
Similarity:173/410 - (42%) Gaps:87/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GAGIYHSIAT-----------------------SFAEQNVVVSPLLLEATLSLLFLGSDGATAEE 56
            |||||..|.|                       ..|::||::||..::..|:||...:...|   
  Fly    55 GAGIYDDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAGT--- 116

  Fly    57 LQKQLRL---KQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQT-- 116
             |.|:.|   :....|...:..||...|.:...:......|..|..|.::|.: :..||...|  
  Fly   117 -QTQVELANTQTDIRSQNNVREFYRKTLNSFKKENQLHETLSVRTKLFTDSFI-ETQQKFTATLK 179

  Fly   117 -YFHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPF 180
             ::.:..|.:|....|.....|:.. .|::..|..:.: ||..:..::::||  .||        
  Fly   180 HFYDSEVEALDFTNPEAAADAINAW-AANITQGRLQQL-VAPDNVRSSVMLL--TNL-------- 232

  Fly   181 SAYRTGLY--EF---HSGSQVKSVPMLFDDDMFVKFAELRD---------LDARAIELPYEHAEE 231
             .|..||:  :|   ..||..:|.    ||....:|.|..|         |.|:.:.|||:... 
  Fly   233 -IYFNGLWRRQFATTFQGSFFRSK----DDQSRAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN- 291

  Fly   232 LSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEI 296
             |:.::||....|:.:|.|.|.:.:|.:.|..|:...|:|.||||..|::.:|::.|:.||..||
  Fly   292 -SLFVLLPYALNGIHDLVKNLENDELKSAQWAMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREI 355

  Fly   297 FAASANFKHLHASAN----LPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVI------SNS 351
            |..||:...|...|:    :.::::|||..||:||.|:.:          |...|:      ..|
  Fly   356 FEDSASLPGLTRGADVAGKVKVSNILQKAGINVNEKGTEA----------YAATVVEIENKFGGS 410

  Fly   352 SRQKFFRADHPFFFAIRSEN 371
            :..:.|..:.||.|.|..|:
  Fly   411 TAIEEFNVNRPFVFFIEEES 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/407 (25%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 97/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.