DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn43Ab

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001027395.1 Gene:Spn43Ab / 45040 FlyBaseID:FBgn0024293 Length:393 Species:Drosophila melanogaster


Alignment Length:383 Identity:107/383 - (27%)
Similarity:185/383 - (48%) Gaps:38/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRL--------KQRFASN 70
            :.|.:|:::|.....:|||:||..::::::|.|:|:.|.||.|||:.|||        .||..| 
  Fly    32 LAADLYNAVAADHLNENVVISPATIQSSMALAFVGAKGQTASELQQGLRLGPGDADAVSQRSGS- 95

  Fly    71 AKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRR 135
                  |...|     ..|...:|.|.:.::........|:.:||..|.:..:.:|.......|.
  Fly    96 ------YQQAL-----TRDNNFRLANNIYINENLEFKGSFRDVAQRQFDSNIDKLDFHPPYNKRT 149

  Fly   136 HIS-EQILASVGGGSWKDIHVAGGSSANTL-LLLLAANLQSKWFLPFSAYRTGLYEFHSGSQVKS 198
            ... .:.:|:...|...||..|...:..|. :::...:..:.|...|...:|....|.:||. :|
  Fly   150 ADGINRAVATKTNGKITDILRAELLNDRTEGVIVNGVSYSAAWQKAFRLDKTEKRSFRTGSG-QS 213

  Fly   199 VPMLFDDDMFV----KFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGA 259
            |.:   |.|:.    .:||:..|||:.:||||:: .:.||||:|||::.||:.|::.|...:|.|
  Fly   214 VKV---DTMWTLQNFNYAEVNSLDAKVVELPYQN-PDFSMLLLLPNRKDGLRSLQQSLSGKNLLA 274

  Fly   260 LQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRIN 324
            ....|..:.|:|||||||:.|...|..|.|:||...:|:...:|.:::   .:.::..:..:...
  Fly   275 EIGAMSQQKVEVLLPKFSVTFGLGLEGPFKKLGVHTMFSRDGDFGNMY---RMFVSHFINAVEHK 336

  Fly   325 LNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVVEF 382
            .|...:.:|.:.|......|.:.    ||.|.|.|||||.|||:.::....:||:..:
  Fly   337 ANVEVTEAGVDQPLETGLLKGLF----SRSKKFEADHPFVFAIKYKDSIAFIGHIANY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 105/374 (28%)
Spn43AbNP_001027395.1 SERPIN 30..387 CDD:238101 106/378 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.