DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb6e

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001039000.2 Gene:Serpinb6e / 435350 MGIID:2667778 Length:429 Species:Mus musculus


Alignment Length:366 Identity:90/366 - (24%)
Similarity:176/366 - (48%) Gaps:34/366 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNIT-TDADT 90
            :.:||..|...:.::|:|:.:|::|.||.::.:.|.|.:.....|.:...:.:.|..:. ||...
Mouse    75 SSKNVFFSSSSMFSSLALILMGANGTTASQISQVLSLDKCSNGGADVQQGFQSLLTEVNKTDTGH 139

  Fly    91 FLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQT-EKLRRHISEQILASVGGGSWKDI- 153
            .|:..|::...:...:.:.|::.....:....|.:|.:.| |:.|:||:..:....     ||: 
Mouse   140 MLRRANKIFSDNNFDIMESFKESCYKLYRVEIEKLDFKGTPEQCRQHINAWVAKKT-----KDVI 199

  Fly   154 ----HVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMF-VKFA 212
                .:...:|...|:|:.|...:.||...|:...|....|. |.::.|:|.|:.....| ..:|
Mouse   200 RELLSLYTVNSNTRLILVNATYFKGKWEKQFNKEDTREMPFKVSKNEKKTVQMMSKKSTFKTYYA 264

  Fly   213 ELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQ----QRMQMEGVQVLL 273
            |  ::....:.|||.. :||||:::||:::..|..:|.|:....|  :|    .:|:.|.|||.|
Mouse   265 E--EISTTIVFLPYTD-KELSMIIMLPDEQVELSMVENQISYKKL--IQWTRLVKMEEEEVQVFL 324

  Fly   274 PKFSIDFECSLRQPLKQLGFEEIFAAS-ANFKHLHASANLPIADVLQKLRINLNESGSGSGPELP 337
            |:|.::....::..|.:||..:.|..| |:|..:.:...|.:::|:.|..:.:||.|:.:..   
Mouse   325 PRFKLEATYDMKDVLCKLGMTDAFEESRADFSGISSKKGLFLSNVVHKSFVEVNEEGTEAAV--- 386

  Fly   338 KNATEYKPIVISNSSRQKFFRADHPFFFAI---RSENVTYL 375
              |||.  :.:.:...|:...||.||.|.|   :|:.:.:|
Mouse   387 --ATEI--VTVGSPLTQRCLIADRPFLFLIQGDKSKEILFL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 90/366 (25%)
Serpinb6eNP_001039000.2 serpin 53..429 CDD:393296 90/366 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.