DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn77Ba

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:378 Identity:88/378 - (23%)
Similarity:166/378 - (43%) Gaps:49/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYA--AELGN 83
            |:....|.::.::||..:.:.|.||:.||:|.|..:|:|.||:.   ..:.|:...|.  :...|
  Fly    88 SVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRIN---VEDEKLRGAYKVWSSFLN 149

  Fly    84 ITTDADTFLQLQNRLMLSSESGVADDFQKIAQTY--------FHATAECVDL-EQTEKLRRHISE 139
            |||.......|| .:.......:.::::...|.|        |::....:.: |.|.:..|.:..
  Fly   150 ITTSTIEVATLQ-AIYTGKGYPIKNNYRDAIQNYNVQPMEVDFYSPDSVIQINEDTNRTTRGLIP 213

  Fly   140 QILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEF--HSGSQVKSVPML 202
            ..:..      :|::.|      .:.||.:...:.:|..||:...|....|  .||..:..:||:
  Fly   214 YTILP------QDVYGA------KMFLLSSLYFKGQWKFPFNKTLTREEPFFSESGEVIGKIPMM 266

  Fly   203 FDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRM--- 264
            ..:..|...:.:..||...:||||...:.|:|:::||.:...|.::...|..|.|..:.||:   
  Fly   267 VQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAF 331

  Fly   265 -----QMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRI 323
                 :...|:|::|||....:.:|:..|.|:|..::| ..:||...:  |:.|....|:...:|
  Fly   332 RNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM--SSGLFAKLVVHSTKI 394

  Fly   324 NLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            .::|.|:.:|.     .||   ..::|.:....|..:.||.:.| .|..|.|:
  Fly   395 IVDEQGTTAGA-----VTE---AALANKATPPKFLLNRPFQYMI-VEKATGLL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 88/378 (23%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 88/378 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.