DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Acp76A

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:394 Identity:84/394 - (21%)
Similarity:151/394 - (38%) Gaps:102/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FAEQNVVVSPLLLEATL-----------------SLLF-LGSDGATAEELQKQLRLKQRFASNAK 72
            :..:|.|:|.|.:|..|                 ||:. .|...|..|.|...||.|:..::..:
  Fly    36 YTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSEARQEVLDWGLRYKKASSAKFQ 100

  Fly    73 MANFYAAELGNITTDADTFLQLQNRLMLSS--ESGVADDFQ--KIAQTYF--HATAECVDLEQTE 131
            |||..|.   :........|:|.|.::::|  :..|..|.:  |:...:.  |......:..|.:
  Fly   101 MANKVAV---SQKLPLSQKLRLVNEVLMTSAKKYDVTKDVRPSKLMDEWLSSHLDGVLANFVQEK 162

  Fly   132 KLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQS---KWFL--PFSAYRTGLYEFH 191
            ||  :..|.|:|               .|..|:..|.|::.||   ::|:  |.:.|        
  Fly   163 KL--NAGENIVA---------------ISGMTVTPLWASHFQSEINRYFVNNPGTGY-------- 202

  Fly   192 SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLD 256
            :......|||:..   ...|..:...:|:.|.:|:..| .|.||::||.:....:::        
  Fly   203 ASKDPTCVPMMHS---LSSFETMSTDEAKGIYIPFSSA-NLGMLILLPRKGVTCKDI-------- 255

  Fly   257 LGALQQRMQME-----GVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIAD 316
            |..|..::.:|     .|.:|||.|...|:.::.:....:..|:.|..|| ||            
  Fly   256 LDNLNNQINVEYNDHKDVHLLLPIFKEKFDYNIAKFFNGINIEDTFKDSA-FK------------ 307

  Fly   317 VLQKLRINLNESGSGSGPELPKNATEYKPI----VIS--NSSRQKFFRADHPFFFAIRSENVTYL 375
              .|.:|.:|......|       ..::||    |:.  ::.:.:.|..:.||.|.|:.:...|.
  Fly   308 --SKAKIKINNFRVNHG-------IRFQPILRLEVVDDIDTGKTETFEVNRPFVFVIKDKINVYA 363

  Fly   376 MGHV 379
            :|.:
  Fly   364 VGRI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 84/392 (21%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 84/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.