DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA2

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:372 Identity:80/372 - (21%)
Similarity:159/372 - (42%) Gaps:28/372 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:|......||:|:|..:....::|.||:...|..|:.:.|.:.......||:...:...|.
Human    64 LYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIHECFQQVLQ 128

  Fly    83 NITTDADTFLQLQ--NRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASV 145
            .::. .||.|||.  :.|.::....:.|.|.:..:..:|:.|..::...||:.:..|:..:....
Human   129 ALSR-PDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAKEQINNYVEKRT 192

  Fly   146 GGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMF 208
            |.   |.:.:......:|.|.|: ..:...||...|.|....:..|| ....:..|||:   :..
Human   193 GR---KVVDLVKHLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRVPMI---NHL 251

  Fly   209 VKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLL 273
            .:|...||.:..:..|...:....:...|||:.: .:.:||::|....|..:|:...:..:.:..
Human   252 GRFDIHRDRELSSWVLAQHYVGNATAFFILPDPK-KMWQLEEKLTYSHLENIQRAFDIRSINLHF 315

  Fly   274 PKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGS--GPEL 336
            ||.||.....|::.|:.||..:||:..|:...:...|.|.::..:....:.::|.|:.:  .|.|
Human   316 PKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQEAPLKLSKAVHVAVLTIDEKGTEATGAPHL 380

  Fly   337 PKNA-TEYKPIVISNSSRQKFFRADHPFFFAIRSE--NVTYLMGHVV 380
            .:.| ::|:.::.           :.||...|:.:  |....:|.||
Human   381 EEKAWSKYQTVMF-----------NRPFLVIIKDDITNFPLFIGKVV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 78/369 (21%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 80/372 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.