DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb3c

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_958751.2 Gene:Serpinb3c / 381286 MGIID:1277952 Length:386 Species:Mus musculus


Alignment Length:406 Identity:101/406 - (24%)
Similarity:176/406 - (43%) Gaps:90/406 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:..|  ::|:..||:.:...|.:|.||:.|.|..:::|.|:.                   
Mouse    15 MYRQLRES--DKNIFYSPISMITALGMLKLGAKGNTEIQIEKVLQC------------------- 58

  Fly    83 NITTDADTFLQLQNRLMLSSESGVADDFQK---------------------------IAQT---- 116
            |.||:..|    :.......|..|.:.|||                           :.||    
Mouse    59 NETTEKTT----EKSAHCDDEDNVHEQFQKLITQLNKSNDDYDLKAANSIYGAKGFPLLQTFLED 119

  Fly   117 ---YFHATAECVDLEQTEKLRRHISEQILASVG-------GGSWKDIHVAGGSSANTLLLLL-AA 170
               |:||..|.:|.|       |.:|:....:.       .|..||:..:|..|::|.|:|: |.
Mouse   120 IKEYYHANVESLDFE-------HAAEESEKKINFWVKNETNGKIKDLFPSGSLSSSTKLVLVNAV 177

  Fly   171 NLQSKWFLPFSAYRT--GLYEFHSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELS 233
            ..:.:|...|....|  .::..:..:.: .|||:...:.|: |:.|.|:.|:.:|:||: .:|||
Mouse   178 YFKGRWNHKFDENNTIEEMFWLNKNTSI-PVPMMKQRNKFM-FSFLEDVQAQIVEIPYK-GKELS 239

  Fly   234 MLLILPNQRGGLQELEKQLHDLDL--GALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEI 296
            |.::||.:..||::|||||....|  ....:.|.:..:.:.||:|.::.:..|..||:.:|....
Mouse   240 MFVLLPMEIDGLKQLEKQLTAAKLLEWTRAENMHLTELYLWLPRFKVEEKYDLPVPLECMGMVNA 304

  Fly   297 F-AASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRAD 360
            | ...|:|..:.::..|.::.||.|..:.:||.|:.:.|...:.       ||...::...||.|
Mouse   305 FDPQKADFSGMSSTQGLVVSKVLHKSFVEVNEEGTEADPASGEE-------VILRLAQVADFRCD 362

  Fly   361 HPF-FFAIRSENVTYL 375
            ||| ||.|.|:..:.|
Mouse   363 HPFLFFIIHSKTNSIL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 101/406 (25%)
Serpinb3cNP_958751.2 SERPIN 6..386 CDD:294093 101/406 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.