DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and AT1G62160

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:165 Identity:44/165 - (26%)
Similarity:70/165 - (42%) Gaps:45/165 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 RAIELPYEHAEE-----LSMLLILPNQRGGLQELEKQLHD----LDLGALQQRMQMEGVQVLLPK 275
            :.:.|||....:     .||...||:::|.|.:|.|::..    ||....::|::::  :..:||
plant    71 KVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTPRERVEVD--EFRIPK 133

  Fly   276 FSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNA 340
            |.|:|           |||    ||:.|.......:.     .||..|.::|.|:.:..     |
plant   134 FKIEF-----------GFE----ASSVFSDFEIDVSF-----YQKALIEIDEEGTEAAA-----A 173

  Fly   341 TEYKPIVISNSSRQKF-----FRADHPFFFAIRSE 370
            |.:    :.|.....|     |.|||||.|.||.|
plant   174 TAF----VDNEDGCGFVETLDFVADHPFLFLIREE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 44/165 (27%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 44/165 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.