DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina11

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:390 Identity:82/390 - (21%)
Similarity:150/390 - (38%) Gaps:75/390 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AANPTPYDCHIGAGIYHSIA---TSFAEQ-----------NVVVSPLLLEATLSLLFLGSDGATA 54
            |..|..:.....|..||.:.   |:||.:           |::.||:.|.:|::||.||:...|.
  Rat    32 APQPASHQSLEPAPAYHKVTPTITNFALRLYKQLAEEIPGNILFSPVSLSSTVALLSLGAHADTQ 96

  Fly    55 EELQKQLRLKQRFASNAKMANFYAAELGNITTDADTF-LQLQNRLMLSSESGVADDFQKIAQTYF 118
            .::.:.|.........|.:...:.:.|..:...:... |:|.:.|.|..:......|...|:..:
  Rat    97 AQILQSLGFNLTETPAADIHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELY 161

  Fly   119 HATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAG---GSSANTLLLLLAAN---LQSKWF 177
            .|.|...:..:.....:.|::.:.....|      .|.|   ....:||::||  |   .::||.
  Rat   162 GALAFSANFTEAAATGQQINDLVRKQTYG------QVVGCLPEFDRDTLMVLL--NYIFFKAKWK 218

  Fly   178 LPFSAYRTGLYE-FHSGSQVK-SVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPN 240
            .||..|:|...| |....::: .:||:...:|. :|  |.|.:|....|..|::....:||:||:
  Rat   219 HPFDRYQTRKQESFFVDQRLQLRIPMMRQKEMH-RF--LYDQEASCTVLQIEYSGTALLLLVLPD 280

  Fly   241 QRGGLQELEKQLH----------------------------------------DLDLGALQQRMQ 265
            . |.:|::|..|.                                        .|.|..||....
  Rat   281 P-GKMQQVEAALQPETLRRWGQRFLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQT 344

  Fly   266 MEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGS 330
            ...:.:.||:||:....:|.:.|..:|...:|...|:...:....|..::.|..|..:::||.|:
  Rat   345 WSLLDLHLPRFSVSATYNLEEILPLVGLSSLFDVEADLSGIMGQLNKTVSRVSHKAVVDMNEKGT 409

  Fly   331  330
              Rat   410  409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 79/376 (21%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 77/369 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.