DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Spn47C

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster


Alignment Length:389 Identity:101/389 - (25%)
Similarity:197/389 - (50%) Gaps:26/389 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAANPTPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQR 66
            |.:|:|..:    ...::.::.......|::|||....:.::|:|:|:.|.:|:||:.:|.|  .
  Fly    10 SLSASPIVF----ARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL--G 68

  Fly    67 FASNAKMANFYAAELGNITTDA--DTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-- 127
            .::.:::|..:|....:..:.|  ...|:|..||.::.|..:..||..:|..:|:|.|..::.  
  Fly    69 VSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN 133

  Fly   128 --EQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAANLQSKWFLPFSAYRTGLYEF 190
              :..:|:.:.:.:....:|......::.    :|.::::|:.:...::||...|....|.:.:|
  Fly   134 PEDSVKKVNKWLEKHTFYTVRNLFTPEVF----NSDSSVILVNSLFFRAKWNKIFPQQLTQIDDF 194

  Fly   191 H-SGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHD 254
            . :..|...|.|:.....| ::.|.:.|.::.::||:|.: .|:|::|||....||.|||::|..
  Fly   195 WINPRQRMEVSMMRQIGQF-RYGESKKLKSQILQLPFERS-NLTMMIILPTAIDGLPELEEKLGQ 257

  Fly   255 LDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIF-AASANFKHL-HASANLPIADV 317
            ||:..:..:..|:.|.|.:|||.|:....|:.||:::|...:| |..|:...| .......|::.
  Fly   258 LDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEA 322

  Fly   318 LQKLRINLNESGSGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVVE 381
            ..|:.:|:.|.|....||     .|.:|.|:..:..:|||:||.||.||||.....|.:||.|:
  Fly   323 RHKVFLNVTEFGCEVAPE-----AEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVGHFVK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 96/369 (26%)
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 96/377 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.