DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb9

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006253934.1 Gene:Serpinb9 / 361241 RGDID:1549730 Length:396 Species:Rattus norvegicus


Alignment Length:363 Identity:83/363 - (22%)
Similarity:169/363 - (46%) Gaps:23/363 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITT 86
            :..|...:||..||:.:.:.|:::.||:.|.|..::.:.|.|.:    ...:...:...|.|:..
  Rat    41 LCQSNPSENVCYSPVSISSALAMVLLGAKGQTQVQISQALGLNK----EKDLHQGFQLLLSNLNK 101

  Fly    87 DADTF-LQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGGS 149
            ....: |::.|||.......:...:::....::::..|.:.. |..|:.|:||:..: :....|.
  Rat   102 PERKYSLRVANRLFADKTCELLPTYKESCLRFYNSEMEQLSFAEAAEESRKHINTWV-SKQTEGK 165

  Fly   150 WKDIHVAGGS--SANTLLLLLAANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKF 211
            ..:: ::|||  |...|:|:.|...:.:|..||:...|....|. :.::.:.|.|:..:|.: ..
  Rat   166 IPEL-LSGGSVDSETRLVLVNALYFKGRWHQPFNKEYTVDMPFKINKNEKRLVQMMCCEDTY-NL 228

  Fly   212 AELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRMQMEGVQVLLP 274
            |.::::.|:.:.:||| ..|||.:::||:..|.|.::|..|  ..|........|:...|:|.||
  Rat   229 AHVKEVQAQVLMMPYE-GMELSFVVLLPDNDGDLSKVESNLTFEKLTAWTNPDFMKNTNVEVFLP 292

  Fly   275 KFSIDFECSLRQPLKQLGFEEIF-AASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPK 338
            ||.:..:..:....::||..::| .|.|:...:....||.::.::.|..:.:||.|:       :
  Rat   293 KFKLQEDYDMESVFQRLGIVDVFQEAKADLSAMSPERNLCVSKIVHKSLVEVNEEGT-------E 350

  Fly   339 NATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            .|.....|....::....|.|||||.|.|:......::
  Rat   351 AAAASAVIEYCCAAFVPTFCADHPFLFFIKHNKTNSIL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 83/363 (23%)
Serpinb9XP_006253934.1 SERPIN 26..396 CDD:294093 83/363 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.