DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and SERPINA9

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:365 Identity:79/365 - (21%)
Similarity:158/365 - (43%) Gaps:30/365 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:......||:..||:.:..:|::|.||:...|..::.:.|.........:.:...:...:.
Human    55 LYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVH 119

  Fly    83 NITTDA-DTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVG 146
            ::|..: |..|::.:.|.:..|..:..:|....:..:.|.....|.......:..|:..:.....
Human   120 SLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQ 184

  Fly   147 GGSWKDIHVAGGSSANTLLLLLAAN---LQSKWFLPF-SAYRTGLYEFHSGSQVK-SVPMLFDDD 206
            |   |.:.:..|....|.::|:  |   .::||..|| ..|....:.|..|.||. .|||:...:
Human   185 G---KVVDIIQGLDLLTAMVLV--NHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKE 244

  Fly   207 MFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQV 271
            .|. |....:|:...:::.|:  .:.....:||: :|.:::||:.|....|......:|...::|
Human   245 QFA-FGVDTELNCFVLQMDYK--GDAVAFFVLPS-KGKMRQLEQALSARTLRKWSHSLQKRWIEV 305

  Fly   272 LLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGPEL 336
            .:|:|||....:|...|.::|.:.:|..:|:|..:....:|.::....|..::::|.|:.:    
Human   306 FIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEA---- 366

  Fly   337 PKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLM 376
             ..||..|.||.|.         |.|.:|.: |.|.|:||
Human   367 -TAATTTKFIVRSK---------DGPSYFTV-SFNRTFLM 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 79/365 (22%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.