DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpina1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:412 Identity:82/412 - (19%)
Similarity:155/412 - (37%) Gaps:103/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYDCHIGAGIYHSIATSFAE-----------------QNVVVSPLLLEATLSLLFLGSDGATAEE 56
            |:..|.|....|.:|...|:                 :|:..||:.:...||||.:|:..:|..:
Zfish    53 PHPSHKGVDACHLLAPHNADFAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQ 117

  Fly    57 LQKQLRLKQRFASNAKMANFYAAELGNITTDADTFLQL----QNRLMLSSESGVA--------DD 109
            :...|             .:.|.....:....:..|.:    |:.:.|.:.:|||        |.
Zfish   118 IYSGL-------------GYSALTPEQVNEGYEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQ 169

  Fly   110 FQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQ 173
            |.|.||.|:::.|..||..:.|.....|::.|......   |..::.....|:|:::|: ....:
Zfish   170 FLKDAQHYYNSEAFGVDFSKPEIAAAEINKFIARKTHD---KITNMVKDLDADTVMMLINYMYFR 231

  Fly   174 SKWFLPFSA---------------------YRTGLYEFHSGSQVKSVPMLFDDDMFVKFAELRDL 217
            .||..||.|                     .|||.|:.:.....::..|:               
Zfish   232 GKWEKPFDAKLTHKADFKVDQDTTVQVDMMKRTGRYDIYQDPVNQTTVMM--------------- 281

  Fly   218 DARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFEC 282
                  :||:  ...||:::||:. |.::|||:.:....|.....::....|.:.:|||||....
Zfish   282 ------VPYK--GNTSMMIVLPDD-GKMKELEESICRHHLKNWHDKLFRSSVDLFMPKFSISATS 337

  Fly   283 SLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGP---------ELPK 338
            .|...||.:|..:.|...|:|..:.....:.::.||.:..::::|.|:.:..         .||.
Zfish   338 KLDGILKDMGMTDAFNDKADFSGMTEEVKVKVSQVLHQAVMSVDEKGTEAAAITTIEIMPMSLPD 402

  Fly   339 NATEYKP---IVISNSSRQKFF 357
            .....:|   :::.:|:....|
Zfish   403 TVILNRPFLVLIVEDSTMSILF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 79/403 (20%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 77/396 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.