DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpinc1

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_878283.1 Gene:serpinc1 / 321545 ZFINID:ZDB-GENE-030131-264 Length:450 Species:Danio rerio


Alignment Length:365 Identity:92/365 - (25%)
Similarity:171/365 - (46%) Gaps:30/365 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG-------NIT 85
            ::|:.:||:.:....::..||:...|.|:|.|..:........:...:|:.|:|.       :.|
Zfish    88 DENIFLSPISISTAFAMTKLGACNTTLEQLMKVFQFDTIKEKTSDQVHFFFAKLNCRLYRKKHET 152

  Fly    86 TDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDLEQTEKLRRHISEQILASVGGGSW 150
            |:    |...|||.....:...:.||.|::|.:.|....:|.::..:..|....:.:|:......
Zfish   153 TE----LISANRLFGDKSTTFNETFQHISETVYGAKLMPLDFKEKPEASRITINEWIANKTENRI 213

  Fly   151 KDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFH-SGSQVKSVPMLFDDDMFVKFAE 213
            ||....|....||:|:|: |...:.:|...|........:|| |.:....|||::.:..| ::|:
Zfish   214 KDTLPEGSIDTNTILVLVNAIYFKGQWKNKFDKQNVMKLDFHVSPTHKCPVPMMYQEKKF-QYAK 277

  Fly   214 LRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSI 278
            :.:...:.:|||| :..:::|:||||.:...|.|:...::...|......|:...|.|.:|:|.:
Zfish   278 IPEDKVKILELPY-NGGDITMVLILPIEGATLSEVVANMNLKKLVGWLHAMKETTVAVQIPRFRV 341

  Fly   279 DFECSLRQPLKQLGFEEIFA-ASANFKHLHASA---NLPIADVLQKLRINLNESGSGSGPELPKN 339
            :...||::.|.::|.|::|: |:|:...:.|.|   ||.|:|...|..:.:||.||        .
Zfish   342 EDSFSLKEQLTKMGLEDLFSPANASLPGMVADAEGPNLFISDAYHKAFLEVNEEGS--------E 398

  Fly   340 ATEYKPIVISNSSRQKF---FRADHPFFFAIRSENVTYLM 376
            |:....:|.:..|...|   |.||.||...||..::..|:
Zfish   399 ASAATAVVATGRSLNIFREQFVADRPFLLFIRESSINALI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 92/365 (25%)
serpinc1NP_878283.1 antithrombin-III_like 62..443 CDD:239000 92/365 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.