DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and serpina1l

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001013277.3 Gene:serpina1l / 321195 ZFINID:ZDB-GENE-040721-3 Length:433 Species:Danio rerio


Alignment Length:387 Identity:82/387 - (21%)
Similarity:156/387 - (40%) Gaps:68/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYDCHIGAGIYHSIATSFAEQ--NVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNA 71
            |::......:|..:|::...|  |:..||:.:...||||.:|:.|:|..::...|          
Zfish    68 PHNADFAFSLYKKLASNPDAQGKNIFFSPVGISMALSLLAVGAKGSTLSQIYSGL---------- 122

  Fly    72 KMANFYAAELGNITTDADTFLQL----QNRLMLSSESGVA--------DDFQKIAQTYFHATAEC 124
               .:.|.....:....:..|.:    |:.:.|.:.:|||        |.|.|.||.|:::.|..
Zfish   123 ---GYSALTPEQVNEGYEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFG 184

  Fly   125 VDLEQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLY 188
            ||..:.|.....|::.|......   |..::.....|:|:::|: ....:.||...|.|..|...
Zfish   185 VDFSKPEIAAAEINKFIARKTHD---KITNMVKDLDADTVMMLINYMYFRGKWEKQFDAKLTHKA 246

  Fly   189 EFHSGSQVKSVPMLFDDDMFVKFAELR-----DL------DARAIELPYEHAEELSMLLILPNQR 242
            :|.           .|.|..|:...::     |:      ....:.:||:  ...|||::|||. 
Zfish   247 DFK-----------VDQDTTVQVDMMKRTGRYDIYQDPVNQTTVLMVPYK--GNTSMLIVLPND- 297

  Fly   243 GGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLH 307
            |.::|||:.:....|.....::....|.:.:|||||.....|...|..:|..:.|...|:|..:.
Zfish   298 GKMKELEESICRHHLKNWHDKLFRSSVDLFMPKFSISATSKLDDILMDMGMTDAFDYKADFSGMT 362

  Fly   308 ASANLPIADVLQKLRINLNESGSGSGP---------ELPKNATEYKP---IVISNSSRQKFF 357
            ....:.::.||.:..::::|.|:.:..         .||......:|   :::.:|:....|
Zfish   363 EEVKVRVSRVLHQAVMSVDEKGTEAAAITTIEIMPMSLPHTVILNRPFLVLIVEDSTMSILF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 81/378 (21%)
serpina1lNP_001013277.3 alpha-1-antitrypsin_like 69..428 CDD:239011 81/386 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.