DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb9d

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:352 Identity:67/352 - (19%)
Similarity:149/352 - (42%) Gaps:42/352 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELGNITTDADTF-LQLQNRLMLSSESGVA 107
            ::.||:.|.||.::.:.|.|.:.  .:..:...:...|.|:......: |::.|||...:...:.
  Rat     1 MVLLGAKGDTAVQISQALNLNKH--PDEDIHKDFQLLLHNLNKPKSHYCLRIANRLFAENTCKLV 63

  Fly   108 DDFQKIAQTYFHATAECVDL-EQTEKLRRHISEQILASVGGGSWKDIHVAGGSSANTLLLLLAAN 171
            ..:::....::::..|.:.. :..|:.|:||:..:.....|...:.:......|...|:::.|..
  Rat    64 PTYKESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALY 128

  Fly   172 LQSKWF----------LPFSAYRTGLYEFHSGSQVKSVPMLFDDDMFVKFAELRDLDARAIELPY 226
            .|..|.          :||...:         .:.|.|.|::.::.| ..|.::::.|:.:.:||
  Rat   129 FQGSWLHCFDKEFTMEMPFKINK---------KETKPVQMMWQEETF-DVAYVKEIQAQILVMPY 183

  Fly   227 EHAEELSMLLILPNQRGGLQELEKQL--HDLDLGALQQRMQMEGVQVLLPKFSIDFECSLRQPLK 289
             ...|:|.:::||::...::::|..|  ..|......:.:....|.|.||||.:..:..:....:
  Rat   184 -RGMEMSFMVLLPDEGVDIRKVESSLTFEKLTAWTKPEFIYSTEVYVYLPKFQLQEQYDMTALFQ 247

  Fly   290 QLGFEEIFA-ASANFKHLHASANLPIADVLQKLRINLNESG----SGSGPELPKNATEYKPIVIS 349
            .||..::|: ..|:...:....:|.::..:.:..:.:||.|    :.|..:...:.:||.|.   
  Rat   248 HLGMIDVFSEIKADLSGMCPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSEYTPT--- 309

  Fly   350 NSSRQKFFRADHPFFFAIRSENVTYLM 376
                   |.||.||.|.||......::
  Rat   310 -------FCADRPFLFFIRHNQTNSIL 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 67/352 (19%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 67/352 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.