DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpinb13

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100638.1 Gene:Serpinb13 / 304690 RGDID:1304661 Length:389 Species:Rattus norvegicus


Alignment Length:383 Identity:97/383 - (25%)
Similarity:166/383 - (43%) Gaps:58/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQL---------RLKQRFASNAKMANFY----- 77
            ::.||..|||.:...:.::.||:.||||.||||.|         |||.......|....:     
  Rat    23 SDGNVFFSPLGISTAIGMILLGTQGATASELQKVLYSEQGTGSSRLKSEEKEIEKTEEIHHQFQK 87

  Fly    78 -AAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAECVDL-----EQTEKLRRH 136
             ..|:...|.|.|  |.:.|||...........:....:.|:||:.|.||.     |..:|:...
  Rat    88 LLTEISKPTKDYD--LIISNRLYGERTYLFLQKYIDYVEKYYHASLEPVDFVNAADESRKKINSW 150

  Fly   137 ISEQILASVGGGSWKDIHVAGGSSANTLLLLL-AANLQSKWFLPFSAYRTGLYEFHSGSQV-KSV 199
            :..|....|     ||:...|..:::|.|:|: ....:..|...|....|...:|.....: |.|
  Rat   151 VESQTNEKV-----KDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEHTKEEDFWLNKNISKPV 210

  Fly   200 PMLFDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQEL------EKQLHDLDLG 258
            .|:.....| .|..|.||.|:.:.:||::: :.||.::|||...||:::      ||.:.....|
  Rat   211 QMMAQCSSF-SFTLLEDLQAKIVGIPYKNS-DFSMFVLLPNDIDGLEKIIDKLSPEKLVEWTSPG 273

  Fly   259 ALQQRMQMEGVQVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRI 323
            .|:||.    |.:.||:..::....|:..|:.:|....|:..|::..:.|.:.|...:.|.:..:
  Rat   274 QLKQRK----VDLRLPRLKVEETYDLQPTLEAVGIHSAFSEHADYSGMSAHSGLQTQNFLHRSFL 334

  Fly   324 NLNESG----SGSGPELPKNATEYKPIVISNSSRQKFFRADHPFFFAIR---SENVTY 374
            .:.|.|    :|:|       ..:|  |:|.:|.: ....:|||.|.:|   |:::.:
  Rat   335 VVTEEGVEATAGTG-------VGFK--VLSAASCE-LVHCNHPFLFFVRHRESDSILF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 97/383 (25%)
Serpinb13NP_001100638.1 SERPIN 4..389 CDD:294093 97/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.