DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina3m

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:381 Identity:93/381 - (24%)
Similarity:177/381 - (46%) Gaps:45/381 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQLRLKQRFASNAKMANFYAAELG 82
            :|..:|....::|||.|||.:.|.|:::.||:.|.|.||:.:.||.....:....:...:...|.
  Rat    58 LYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESYETDIHQGFGHLLQ 122

  Fly    83 NITTDADTFLQLQ----NRLMLSSESGVADDFQKIAQTYFHATAECVDLEQ---TEKLRRHISEQ 140
            .::...|   |::    |.|.:.....|..:||:..:..:...|...|.:|   ||||   |::.
  Rat   123 RLSQPGD---QVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRVTEKL---INDY 181

  Fly   141 ILASVGGGSWKDIHVAGGSSANTLLLLLAANL-QSKWFLPFSAYRTGLYEFHSGSQ--VKSVPML 202
            :.....|   |...:..|....|.::|:...| :.||.:||....|...||:...:  || |.|:
  Rat   182 VRNQTQG---KIQELVSGLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVK-VSMM 242

  Fly   203 FDDDMFVKFAELRDLDARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQME 267
            ..:::...:....:|....:||.|  ....|.|.|||: :|.:|::|..|....|...:..::..
  Rat   243 KIEELTTPYFRDEELSCSVLELKY--TGNSSALFILPD-KGRMQQVEASLQPETLKKWKDSLRPR 304

  Fly   268 GV-QVLLPKFSIDFECSLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESG-- 329
            .: ::.||:.||..:.||.:.|.:||..::|:..|:...:..:.:|.::.|:.|:.:::||:|  
  Rat   305 KIDELYLPRLSISTDYSLEEVLPELGIRDVFSQQADLSRITGAKDLSVSQVVHKVVLDVNETGTE 369

  Fly   330 --SGSGPEL-PKNATEYKPIVISNSSRQKFFRADHPFFFAIRSENVTYLMGHVVEF 382
              :.:|..| |::..  .|:::       :|  :.||..|     |::..|..:.|
  Rat   370 AAAATGANLVPRSGR--PPMIV-------WF--NRPFLIA-----VSHTHGQTILF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 92/376 (24%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 93/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.