DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn31A and Serpina9

DIOPT Version :9

Sequence 1:NP_609341.1 Gene:Spn31A / 34339 FlyBaseID:FBgn0032178 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100224.1 Gene:Serpina9 / 299274 RGDID:1304789 Length:417 Species:Rattus norvegicus


Alignment Length:419 Identity:86/419 - (20%)
Similarity:159/419 - (37%) Gaps:90/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEAANP----TPYDCHIGAGIYHSIATSFAEQNVVVSPLLLEATLSLLFLGSDGATAEELQKQL 61
            :|...||    ||.:......:|..:|.....||::.||:.:..:|::|.||:..||..::.:.|
  Rat    35 LSMKRNPASQVTPSNTKFAFLLYQRLAQKSPGQNILFSPVSISTSLAMLSLGACSATKTQILRSL 99

  Fly    62 RLKQRFASNAKMANFYAAELGNITTDADTFLQLQNRLMLSSESGVADDFQKIAQTYFHATAEC-V 125
            ..                   |||..|:..:.|              .|:::.    |:..|| .
  Rat   100 GF-------------------NITHIAEHTIHL--------------GFEQLV----HSLNECHK 127

  Fly   126 DLE---------------------------QTEKLRRHISEQILASVGGGSWKDIHVAGG----- 158
            |||                           .|:......|..:.|.....|:.:....|.     
  Rat   128 DLELRMGSVLFIRKELQLQVKFLDRVKKLYGTKVFSEDFSNAVTAQAQINSYVERETKGKVVDVI 192

  Fly   159 ---SSANTLLLLLAANLQSKWFLPFSAYRTGL---YEFHSGSQVKSVPMLFDDDMFVKFAELRDL 217
               .|...::|:.....::.|..||||..|..   :....|:.| .|||:...:.|. |...|:|
  Rat   193 QDLDSQTAMVLVNHIFFKANWTQPFSAANTNKSFPFLLSKGTTV-HVPMMHQTESFA-FGVDREL 255

  Fly   218 DARAIELPYEHAEELSMLLILPNQRGGLQELEKQLHDLDLGALQQRMQMEGVQVLLPKFSIDFEC 282
            ....:::.|.  .:.....:||. :|.:::||:.|....|....:.:|...::|.:|||||....
  Rat   256 GCSILQMDYR--GDAVAFFVLPG-KGKMRQLERSLSPRRLRRWSRSLQKRWIKVFIPKFSISASY 317

  Fly   283 SLRQPLKQLGFEEIFAASANFKHLHASANLPIADVLQKLRINLNESGSGSGPELPKNATEYKPIV 347
            :|...|.::|..:.|.::|:|..:..:..|.::....|..::::|.|:.:..     ||..|.||
  Rat   318 NLETILPEMGIRDAFNSNADFSGITKTHFLQVSKAAHKAVLDVSEEGTEAAA-----ATTTKLIV 377

  Fly   348 ISNSSRQKFFRADHPFFFAIRSENVTYLM 376
            .|..:.......:.||...:..:|...::
  Rat   378 RSRDTPSSTIAFNEPFLILLLDKNTESIL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn31ANP_609341.1 SERPIN 18..379 CDD:238101 81/398 (20%)
Serpina9NP_001100224.1 serpin 32..417 CDD:422956 86/419 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.